gimp/app/widgets/gimpgradienteditor.c

2369 lines
77 KiB
C
Raw Normal View History

/* GIMP - The GNU Image Manipulation Program
1997-11-24 22:05:25 +00:00
* Copyright (C) 1995 Spencer Kimball and Peter Mattis
*
* Gradient editor module copyight (C) 1996-1997 Federico Mena Quintero
* federico@nuclecu.unam.mx
*
* This program is free software: you can redistribute it and/or modify
1997-11-24 22:05:25 +00:00
* it under the terms of the GNU General Public License as published by
* the Free Software Foundation; either version 3 of the License, or
1997-11-24 22:05:25 +00:00
* (at your option) any later version.
*
* This program is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURIGHTE. See the
* GNU General Public License for more details.
*
* You should have received a copy of the GNU General Public License
* along with this program. If not, see <https://www.gnu.org/licenses/>.
1997-11-24 22:05:25 +00:00
*/
/* Special thanks to:
*
* Luis Albarran (luis4@mindspring.com) - Nice UI suggestions
*
* Miguel de Icaza (miguel@nuclecu.unam.mx) - Pop-up menu suggestion
*
* Marcelo Malheiros (malheiro@dca.fee.unicamp.br) - many, many
* suggestions, nice gradient files
*
* Adam Moss (adam@uunet.pipex.com) - idea for the hint bar
*
* Everyone on #gimp - many suggestions
*/
/* TODO:
*
* - Add all of Marcelo's neat suggestions:
* - Hue rotate, saturation, brightness, contrast.
*
* - Better handling of bogus gradient files and inconsistent
* segments. Do not loop indefinitely in seg_get_segment_at() if
* there is a missing segment between two others.
*/
#include "config.h"
1997-11-24 22:05:25 +00:00
#include <stdlib.h>
#include <string.h>
#include <gegl.h>
#include <gtk/gtk.h>
Makefile.am configure.in added stuff for the new library below. 2001-01-23 Michael Natterer <mitch@gimp.org> * Makefile.am * configure.in * gimptool.in: added stuff for the new library below. * libgimpcolor/.cvsignore * libgimpcolor/Makefile.am * libgimpcolor/gimpcolor.h * libgimpcolor/gimpcolorspace.c * libgimpcolor/gimpcolorspace.h * libgimpcolor/gimpcolortypes.h * libgimpcolor/gimphsv.c * libgimpcolor/gimphsv.h * libgimpcolor/gimprgb.c * libgimpcolor/gimprgb.h: new shared library which both the app and plug-ins link against. The library depends only on glib. * libgimpcolor/gimpcolor.def * libgimpcolor/makefile.mingw.in * libgimpcolor/makefile.msc: added Win32 build files which definitely don't work. * libgimp/Makefile.am * libgimp/gimpcolor.[ch] * libgimp/gimpcolorspace.[ch]: removed. * libgimp/gimp.h * libgimp/gimpadaptivesupersample.c * libgimp/gimpbilinear.c * libgimp/gimppalette.c * libgimp/gimptypes.h: include the stuff from libgimpcolor. Plug-Ins don't need to include <libgimpcolor/gimpcolor.h> explicitely. LibGimp depends on libgimpcolor and thus also includes it's headers. * libgimp/gimp.def * libgimp/makefile.mingw.in: fiddled around with Win32 stuff... * app/Makefile.am: link against libgimpcolor.la * app/apptypes.h: include "libgimpcolor/gimpcolortypes.h" * app/asupsample.c * app/channels_dialog.c * app/colormap_dialog.c * app/commands.c * app/convert.c * app/devices.c * app/disp_callbacks.c * app/drawable.c * app/gimpcontext.c * app/gimpdnd.c * app/gimpimage.c * app/gimppalette.c * app/gimprc.c * app/gradient.c * app/libgimp_glue.c * app/palette.c * app/palette_import.c * app/qmask.c * app/xcf.c * app/tools/paint_core.c * app/tools/paintbrush.c * app/tools/pencil.c: include "libgimpcolor/gimpcolor.h" before all gimp includes because it's a standalone library. * plug-ins/FractalExplorer/Makefile.am * plug-ins/Lighting/Makefile.am * plug-ins/MapObject/Makefile.am * plug-ins/bmp/Makefile.am * plug-ins/common/Makefile.am * plug-ins/common/mkgen.pl * plug-ins/dbbrowser/Makefile.am * plug-ins/faxg3/Makefile.am * plug-ins/fits/Makefile.am * plug-ins/flame/Makefile.am * plug-ins/fp/Makefile.am * plug-ins/gap/Makefile.am * plug-ins/gdyntext/Makefile.am * plug-ins/gfig/Makefile.am * plug-ins/gflare/Makefile.am * plug-ins/gfli/Makefile.am * plug-ins/gimpressionist/Makefile.am * plug-ins/helpbrowser/Makefile.am * plug-ins/ifscompose/Makefile.am * plug-ins/imagemap/Makefile.am * plug-ins/maze/Makefile.am * plug-ins/mosaic/Makefile.am * plug-ins/pagecurl/Makefile.am * plug-ins/print/Makefile.am * plug-ins/rcm/Makefile.am * plug-ins/script-fu/Makefile.am * plug-ins/sel2path/Makefile.am * plug-ins/sgi/Makefile.am * plug-ins/webbrowser/Makefile.am * plug-ins/xjt/Makefile.am: add libgimpcolor.la to LDADD. * INSTALL: don't recommend to --disable-shared for development. * TODO.xml: increased some percentages, added plug-in help stuff.
2001-01-23 18:49:44 +00:00
#include "libgimpcolor/gimpcolor.h"
#include "libgimpmath/gimpmath.h"
#include "libgimpbase/gimpbase.h"
Makefile.am configure.in added the new library below. 2001-01-24 Michael Natterer <mitch@gimp.org> * Makefile.am * configure.in * gimptool.in: added the new library below. * libgimpwidgets/Makefile.am * libgimpwidgets/gimpchainbutton.[ch] * libgimpwidgets/gimpcolorarea.[ch] * libgimpwidgets/gimpcolorbutton.[ch] * libgimpwidgets/gimpdialog.[ch] * libgimpwidgets/gimpfileselection.[ch] * libgimpwidgets/gimphelpui.[ch] * libgimpwidgets/gimppatheditor.[ch] * libgimpwidgets/gimppixmap.[ch] * libgimpwidgets/gimpquerybox.[ch] * libgimpwidgets/gimpsizeentry.[ch] * libgimpwidgets/gimpunitmenu.[ch] * libgimpwidgets/gimpwidgets.[ch] * libgimpwidgets/gimpwidgets.def * libgimpwidgets/gimpwidgetstypes.h: new shared library. Currently there are some ugly dependencies into libgimp. These will be removed and go to a "libgimpglue" library which will be a library for functions which share a common interface between plug-ins and the app but have different implementations. Include "libgimp/gimpunit.h" from "libgimpwidgets/gimpwidgetstypes.h" to simulate this upcoming separation. * libgimp/Makefile.am * libgimp/gimpchainbutton.[ch] * libgimp/gimpcolorarea.[ch] * libgimp/gimpcolorbutton.[ch] * libgimp/gimpdialog.[ch] * libgimp/gimpfileselection.[ch] * libgimp/gimphelpui.[ch] * libgimp/gimppatheditor.[ch] * libgimp/gimppixmap.[ch] * libgimp/gimpquerybox.[ch] * libgimp/gimpsizeentry.[ch] * libgimp/gimpunitmenu.[ch] * libgimp/gimpwidgets.[ch]: removed from here. * libgimp/gimpui.h * libgimp/gimpuitypes.h * libgimp/makefile.mingw.in * libgimp/makefile.msc: changed accordingly. * app/[all ui files] * app/pdb/palette_cmds.c * app/pdb/tools_cmds.c * tools/pdbgen/pdb/palette.pdb * tools/pdbgen/pdb/tools.pdb: #include "libgimpwidgets/gimpwidgets.h" and removed useless includes. * app/apptypes.h: #include "libgimpwidgets/gimpwidgetstypes.h" * app/Makefile.am * plug-ins/[all makefiles which link against libgimpui]: link against libgimpwidgets.la * po-libgimp/POTFILES.in: changed file locations.
2001-01-24 22:36:18 +00:00
#include "libgimpwidgets/gimpwidgets.h"
Makefile.am configure.in added stuff for the new library below. 2001-01-23 Michael Natterer <mitch@gimp.org> * Makefile.am * configure.in * gimptool.in: added stuff for the new library below. * libgimpcolor/.cvsignore * libgimpcolor/Makefile.am * libgimpcolor/gimpcolor.h * libgimpcolor/gimpcolorspace.c * libgimpcolor/gimpcolorspace.h * libgimpcolor/gimpcolortypes.h * libgimpcolor/gimphsv.c * libgimpcolor/gimphsv.h * libgimpcolor/gimprgb.c * libgimpcolor/gimprgb.h: new shared library which both the app and plug-ins link against. The library depends only on glib. * libgimpcolor/gimpcolor.def * libgimpcolor/makefile.mingw.in * libgimpcolor/makefile.msc: added Win32 build files which definitely don't work. * libgimp/Makefile.am * libgimp/gimpcolor.[ch] * libgimp/gimpcolorspace.[ch]: removed. * libgimp/gimp.h * libgimp/gimpadaptivesupersample.c * libgimp/gimpbilinear.c * libgimp/gimppalette.c * libgimp/gimptypes.h: include the stuff from libgimpcolor. Plug-Ins don't need to include <libgimpcolor/gimpcolor.h> explicitely. LibGimp depends on libgimpcolor and thus also includes it's headers. * libgimp/gimp.def * libgimp/makefile.mingw.in: fiddled around with Win32 stuff... * app/Makefile.am: link against libgimpcolor.la * app/apptypes.h: include "libgimpcolor/gimpcolortypes.h" * app/asupsample.c * app/channels_dialog.c * app/colormap_dialog.c * app/commands.c * app/convert.c * app/devices.c * app/disp_callbacks.c * app/drawable.c * app/gimpcontext.c * app/gimpdnd.c * app/gimpimage.c * app/gimppalette.c * app/gimprc.c * app/gradient.c * app/libgimp_glue.c * app/palette.c * app/palette_import.c * app/qmask.c * app/xcf.c * app/tools/paint_core.c * app/tools/paintbrush.c * app/tools/pencil.c: include "libgimpcolor/gimpcolor.h" before all gimp includes because it's a standalone library. * plug-ins/FractalExplorer/Makefile.am * plug-ins/Lighting/Makefile.am * plug-ins/MapObject/Makefile.am * plug-ins/bmp/Makefile.am * plug-ins/common/Makefile.am * plug-ins/common/mkgen.pl * plug-ins/dbbrowser/Makefile.am * plug-ins/faxg3/Makefile.am * plug-ins/fits/Makefile.am * plug-ins/flame/Makefile.am * plug-ins/fp/Makefile.am * plug-ins/gap/Makefile.am * plug-ins/gdyntext/Makefile.am * plug-ins/gfig/Makefile.am * plug-ins/gflare/Makefile.am * plug-ins/gfli/Makefile.am * plug-ins/gimpressionist/Makefile.am * plug-ins/helpbrowser/Makefile.am * plug-ins/ifscompose/Makefile.am * plug-ins/imagemap/Makefile.am * plug-ins/maze/Makefile.am * plug-ins/mosaic/Makefile.am * plug-ins/pagecurl/Makefile.am * plug-ins/print/Makefile.am * plug-ins/rcm/Makefile.am * plug-ins/script-fu/Makefile.am * plug-ins/sel2path/Makefile.am * plug-ins/sgi/Makefile.am * plug-ins/webbrowser/Makefile.am * plug-ins/xjt/Makefile.am: add libgimpcolor.la to LDADD. * INSTALL: don't recommend to --disable-shared for development. * TODO.xml: increased some percentages, added plug-in help stuff.
2001-01-23 18:49:44 +00:00
#include "widgets-types.h"
app/core/Makefile.am app/core/core-types.h added an "application object" 2001-07-04 Michael Natterer <mitch@gimp.org> * app/core/Makefile.am * app/core/core-types.h * app/core/gimp.[ch]: added an "application object" called Gimp. Currently, it contains the image list, the clipboard, the data factories, the procedural hashtable and the tool info list. It's the toplevel object of the core object system. Finally, creating a Gimp object will return a standalone gimp core engine instance with no other global states/variables involved. * app/app_procs.[ch]: allocate a "Gimp" instance called "the_gimp" :) Removed stuff which is now done by the "Gimp" object. Merged gimp_init() into app_init() because gimp_init() is taken now. * app/context_manager.[ch]: removed stuff done by "Gimp". * app/batch.[ch] * app/gimage.[ch] * app/xcf/xcf-load.[ch] * app/xcf/xcf.[ch] * app/core/gimpedit.[ch] * app/tools/tool_manager.[ch]: pass around an additional "Gimp" argument. * app/pdb/procedural_db.[ch]: pass a "Gimp" pointer as first parameter to all internal procedures and to all procedural_db_* functions. * app/core/gimpcontext.[ch] * app/core/gimpimage.[ch]: added a "Gimp" pointer to the structs. * app/devices.c * app/errors.c * app/file-open.c * app/file-save.c * app/gimphelp.c * app/gimpunit.c * app/image_new.c * app/main.c * app/nav_window.c * app/plug_in.c * app/base/base.c * app/core/gimpdatafactory.c * app/core/gimpimage-duplicate.c * app/core/gimpimage-mask.c * app/core/gimptoolinfo.[ch] * app/gui/brush-select.c * app/gui/convert-dialog.c * app/gui/dialogs-constructors.c * app/gui/edit-commands.c * app/gui/file-open-dialog.c * app/gui/file-save-dialog.c * app/gui/gradient-editor.c * app/gui/gradient-select.c * app/gui/gui.c * app/gui/image-commands.c * app/gui/info-window.c * app/gui/menus.c * app/gui/palette-editor.c * app/gui/palette-import-dialog.c * app/gui/palette-select.c * app/gui/paths-dialog.c * app/gui/pattern-select.c * app/gui/preferences-dialog.c * app/gui/test-commands.c * app/gui/toolbox.c * app/gui/tools-commands.c * app/tools/gimpbezierselecttool.c * app/tools/gimpbucketfilltool.c * app/tools/gimppainttool.h * app/tools/gimptexttool.c * app/tools/gimptransformtool.h * app/widgets/gimpbufferview.c * app/widgets/gimpcontainerview-utils.c * app/widgets/gimpcursor.c * app/widgets/gimpdnd.c * app/widgets/gimpimagedock.c: changed accordingly. Cleaned up lots of includes. Many files still access the global "the_gimp" variable exported by app_procs.h. * tools/pdbgen/app.pl * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/brushes.pdb * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/palette.pdb * tools/pdbgen/pdb/pattern_select.pdb * tools/pdbgen/pdb/patterns.pdb * tools/pdbgen/pdb/procedural_db.pdb: changed accordingly. Don't use "the_gimp" here because all procedures get passed a "Gimp" pointer now. * app/pdb/*: regenerated.
2001-07-04 19:31:35 +00:00
#include "core/gimp.h"
#include "core/gimpcontainer.h"
#include "core/gimpcontext.h"
#include "core/gimpdatafactory.h"
#include "core/gimpgradient.h"
#include "gimpcolordialog.h"
#include "gimpdialogfactory.h"
#include "gimpdnd.h"
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
#include "gimpdocked.h"
#include "gimpgradienteditor.h"
#include "gimphelp-ids.h"
#include "gimpuimanager.h"
#include "gimpview.h"
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
#include "gimpviewrenderergradient.h"
#include "gimpwidgets-utils.h"
#include "gimp-intl.h"
1997-11-24 22:05:25 +00:00
#define EPSILON 1e-10
1999-10-28 15:05:49 +00:00
#define GRAD_SCROLLBAR_STEP_SIZE 0.05
#define GRAD_SCROLLBAR_PAGE_SIZE 0.5
1999-10-28 15:05:49 +00:00
#define GRAD_VIEW_SIZE 96
#define GRAD_CONTROL_HEIGHT 14
#define GRAD_CURRENT_COLOR_WIDTH 16
1999-10-28 15:05:49 +00:00
#define GRAD_MOVE_TIME 150 /* ms between mouse click and detection of movement in gradient control */
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
#define GRAD_VIEW_EVENT_MASK (GDK_EXPOSURE_MASK | \
GDK_LEAVE_NOTIFY_MASK | \
GDK_POINTER_MOTION_MASK | \
GDK_POINTER_MOTION_HINT_MASK | \
GDK_BUTTON_PRESS_MASK | \
GDK_BUTTON_RELEASE_MASK | \
GDK_SCROLL_MASK | \
GDK_SMOOTH_SCROLL_MASK | \
GDK_TOUCHPAD_GESTURE_MASK)
app/airbrush.c app/apptypes.h app/brushes_cmds.c 1999-11-14 Michael Natterer <mitch@gimp.org> * app/airbrush.c * app/apptypes.h * app/brushes_cmds.c * tools/pdbgen/pdb/brushes.pdb * app/bucket_fill.c * app/clone.c * app/gimpbrushpipe.c * app/paint_core.c * app/patterns.h * app/patterns_cmds.c * tools/pdbgen/pdb/patterns.pdb: removed the GimpBrushP and GPatternP types and use ordinary pointers instead. The following stuff makes the "no_data" behaviour consistent. As a side-effect it should make the gimp work when there are _really_ no brushes/patterns/gradients. * app/brush_select.c * app/pattern_select.c: set the initial brush/pattern name to "No Brushes/Patterns available" instead of "Active". * app/devices.c: set the device contexts' brush/pattern/gradient names if we started with no_data, so we find them on refresh. * app/gimpbrushlist.c: set the name of the standard_brush to "Standard". * app/gimpcontext.c: don't replace the current brush/pattern/gradient's name if the new one to be set is the standard one. Together with the change in devices.c, this ensures that we get what is set in devicerc. Minor fixes. * app/gradient.c: changed gradients_init() to work like the other data init functions. Only insert a default gradient in the gradients list when the editor is opened (this means that the gradients now behave like brushes/patterns when we start with "no_data"). New function gradient_update() avoids tons of useless redraws of all clist gradient previews whenever the gradient editor wants to update it's large preview. * app/gradient_select.c: don't segfault when the user tries to drag from an empty gradient list. * app/patterns.c: set the index of the standard_pattern to -1 to indicate that it's not part of the pattern list.
1999-11-14 10:50:19 +00:00
#define GRAD_CONTROL_EVENT_MASK (GDK_EXPOSURE_MASK | \
GDK_LEAVE_NOTIFY_MASK | \
GDK_POINTER_MOTION_MASK | \
GDK_POINTER_MOTION_HINT_MASK | \
GDK_BUTTON_PRESS_MASK | \
GDK_BUTTON_RELEASE_MASK | \
GDK_SCROLL_MASK | \
GDK_SMOOTH_SCROLL_MASK | \
GDK_BUTTON1_MOTION_MASK)
1999-10-28 15:05:49 +00:00
/* local function prototypes */
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
static void gimp_gradient_editor_docked_iface_init (GimpDockedInterface *face);
static void gimp_gradient_editor_constructed (GObject *object);
static void gimp_gradient_editor_dispose (GObject *object);
static void gimp_gradient_editor_unmap (GtkWidget *widget);
static void gimp_gradient_editor_set_data (GimpDataEditor *editor,
GimpData *data);
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
static void gimp_gradient_editor_set_context (GimpDocked *docked,
GimpContext *context);
static void gimp_gradient_editor_update (GimpGradientEditor *editor);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
static void gimp_gradient_editor_gradient_dirty (GimpGradientEditor *editor,
GimpGradient *gradient);
static void gradient_editor_drop_gradient (GtkWidget *widget,
gint x,
gint y,
GimpViewable *viewable,
gpointer data);
static void gradient_editor_drop_color (GtkWidget *widget,
gint x,
gint y,
const GimpRGB *color,
gpointer data);
static void gradient_editor_control_drop_color (GtkWidget *widget,
gint x,
gint y,
const GimpRGB *color,
gpointer data);
static void gradient_editor_scrollbar_update (GtkAdjustment *adj,
GimpGradientEditor *editor);
static void gradient_editor_set_hint (GimpGradientEditor *editor,
const gchar *str1,
const gchar *str2,
const gchar *str3,
const gchar *str4);
static GimpGradientSegment *
gradient_editor_save_selection (GimpGradientEditor *editor);
static void gradient_editor_replace_selection (GimpGradientEditor *editor,
GimpGradientSegment *replace_seg);
static void gradient_editor_left_color_update (GimpColorDialog *dialog,
const GimpRGB *color,
GimpColorDialogState state,
GimpGradientEditor *editor);
static void gradient_editor_right_color_update (GimpColorDialog *dialog,
const GimpRGB *color,
GimpColorDialogState state,
GimpGradientEditor *editor);
1997-11-24 22:05:25 +00:00
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
/* Gradient view functions */
1997-11-24 22:05:25 +00:00
static gboolean view_events (GtkWidget *widget,
GdkEvent *event,
GimpGradientEditor *editor);
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
static void view_set_hint (GimpGradientEditor *editor,
gint x);
static void view_pick_color (GimpGradientEditor *editor,
GimpColorPickTarget pick_target,
GimpColorPickState pick_state,
gint x);
static void view_zoom_gesture_begin (GtkGestureZoom *gesture,
GdkEventSequence *sequence,
GimpGradientEditor *editor);
static void view_zoom_gesture_update (GtkGestureZoom *gesture,
GdkEventSequence *sequence,
GimpGradientEditor *editor);
static gdouble view_get_normalized_last_x_pos (GimpGradientEditor *editor);
1997-11-24 22:05:25 +00:00
/* Gradient control functions */
static gboolean control_events (GtkWidget *widget,
GdkEvent *event,
GimpGradientEditor *editor);
static gboolean control_draw (GtkWidget *widget,
cairo_t *cr,
GimpGradientEditor *editor);
static void control_do_hint (GimpGradientEditor *editor,
gint x,
gint y);
static void control_button_press (GimpGradientEditor *editor,
GdkEventButton *bevent);
static gboolean control_point_in_handle (GimpGradientEditor *editor,
GimpGradient *gradient,
gint x,
gint y,
GimpGradientSegment *seg,
GradientEditorDragMode handle);
static void control_select_single_segment (GimpGradientEditor *editor,
GimpGradientSegment *seg);
static void control_extend_selection (GimpGradientEditor *editor,
GimpGradientSegment *seg,
gdouble pos);
static void control_motion (GimpGradientEditor *editor,
GimpGradient *gradient,
gint x);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
static void control_compress_left (GimpGradient *gradient,
GimpGradientSegment *range_l,
GimpGradientSegment *range_r,
GimpGradientSegment *drag_seg,
gdouble pos);
static double control_move (GimpGradientEditor *editor,
GimpGradientSegment *range_l,
GimpGradientSegment *range_r,
gdouble delta);
static gdouble control_get_normalized_last_x_pos (GimpGradientEditor *editor);
/* Control update/redraw functions */
static void control_update (GimpGradientEditor *editor,
2003-03-10 14:07:22 +00:00
GimpGradient *gradient,
gboolean recalculate);
static void control_draw_all (GimpGradientEditor *editor,
GimpGradient *gradient,
cairo_t *cr,
gint width,
gint height,
gdouble left,
gdouble right);
static void control_draw_handle (GimpGradientEditor *editor,
GtkStyleContext *style,
cairo_t *cr,
gdouble pos,
gint height,
gboolean middle,
GtkStateFlags flags);
static gint control_calc_p_pos (GimpGradientEditor *editor,
gdouble pos);
static gdouble control_calc_g_pos (GimpGradientEditor *editor,
gint pos);
1997-11-24 22:05:25 +00:00
/* Segment functions */
static void seg_get_closest_handle (GimpGradient *grad,
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gdouble pos,
GimpGradientSegment **seg,
GradientEditorDragMode *handle);
static gboolean seg_in_selection (GimpGradient *grad,
GimpGradientSegment *seg,
GimpGradientSegment *left,
GimpGradientSegment *right);
1997-11-24 22:05:25 +00:00
static GtkWidget * gradient_hint_label_add (GtkBox *box);
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
G_DEFINE_TYPE_WITH_CODE (GimpGradientEditor, gimp_gradient_editor,
GIMP_TYPE_DATA_EDITOR,
G_IMPLEMENT_INTERFACE (GIMP_TYPE_DOCKED,
gimp_gradient_editor_docked_iface_init))
2001-02-14 01:42:12 +00:00
#define parent_class gimp_gradient_editor_parent_class
2001-02-14 01:42:12 +00:00
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
static GimpDockedInterface *parent_docked_iface = NULL;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
static void
gimp_gradient_editor_class_init (GimpGradientEditorClass *klass)
{
GObjectClass *object_class = G_OBJECT_CLASS (klass);
GtkWidgetClass *widget_class = GTK_WIDGET_CLASS (klass);
GimpDataEditorClass *editor_class = GIMP_DATA_EDITOR_CLASS (klass);
1997-11-24 22:05:25 +00:00
object_class->constructed = gimp_gradient_editor_constructed;
object_class->dispose = gimp_gradient_editor_dispose;
widget_class->unmap = gimp_gradient_editor_unmap;
editor_class->set_data = gimp_gradient_editor_set_data;
editor_class->title = _("Gradient Editor");
}
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
static void
gimp_gradient_editor_docked_iface_init (GimpDockedInterface *iface)
{
parent_docked_iface = g_type_interface_peek_parent (iface);
if (! parent_docked_iface)
parent_docked_iface = g_type_default_interface_peek (GIMP_TYPE_DOCKED);
iface->set_context = gimp_gradient_editor_set_context;
}
static void
gimp_gradient_editor_init (GimpGradientEditor *editor)
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (editor);
GtkWidget *frame;
GtkWidget *vbox;
GtkWidget *hbox;
GtkWidget *hint_vbox;
GimpRGB transp;
gimp_rgba_set (&transp, 0.0, 0.0, 0.0, 0.0);
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
/* Frame for gradient view and gradient control */
new ui for the "Layer Offset" dialog. 1999-07-22 Michael Natterer <mitschel@cs.tu-berlin.de> * app/channel_ops.[ch]: new ui for the "Layer Offset" dialog. * app/channels_dialog.c * app/layers_dialog.c: major code cleanup: Folded some callbacks into common ones, "widget" instead of "w", indentation, ... * app/commands.c * app/interface.[ch] * app/global_edit.c: the query boxes must be shown by the caller now. There's no need to split up the string for the message box manually as the Gtk 1.2 label widget handles newlines corectly. Added the "edge_lock" toggle to the "Shrink Selection" dialog. Nicer spacings for the query and message boxes. * app/ink.c: tried to grab the pointer in the blob preview but failed. Left the code there as a reminder (commented out). * app/menus.c: reordered <Image>/Select. I was bored and grep-ed the sources for ancient or deprecated stuff: * app/about_dialog.[ch] * app/actionarea.[ch] * app/app_procs.c * app/brush_edit.c * app/brush_select.c * app/color_select.c * app/convert.c * app/devices.c * app/gdisplay.c * app/gdisplay_ops.c * app/histogram_tool.[ch] * app/info_window.c * app/install.c * app/ops_buttons.c * app/palette.c * app/palette_select.c * app/paths_dialog.c * app/pattern_select.c * app/resize.c * app/scale_toolc.c * app/text_tool.c: s/container_border_width/container_set_border_width/g, s/sprintf/g_snprintf/g, replaced some constant string lengths with strlen(x). * app/bezier_select.c * app/blend.c * app/boundary.c * app/errors.[ch] * app/free_select.c * app/gimpbrushlist.c * app/gimprc.c * app/iscissors.c * app/main.c * app/patterns.[ch] * app/text_tool.c: namespace fanaticism: prefixed all gimp error functions with "gimp_" and formated the messages more uniformly. * app/gradient.c * app/gradient_select.c: same stuff as above for the ui code. There are still some sub-dialogs which need cleanup. Did some cleanup in most of these files: prototypes, removed tons of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
frame = gtk_frame_new (NULL);
gtk_frame_set_shadow_type (GTK_FRAME (frame), GTK_SHADOW_IN);
gtk_box_pack_start (GTK_BOX (editor), frame, TRUE, TRUE, 0);
new ui for the "Layer Offset" dialog. 1999-07-22 Michael Natterer <mitschel@cs.tu-berlin.de> * app/channel_ops.[ch]: new ui for the "Layer Offset" dialog. * app/channels_dialog.c * app/layers_dialog.c: major code cleanup: Folded some callbacks into common ones, "widget" instead of "w", indentation, ... * app/commands.c * app/interface.[ch] * app/global_edit.c: the query boxes must be shown by the caller now. There's no need to split up the string for the message box manually as the Gtk 1.2 label widget handles newlines corectly. Added the "edge_lock" toggle to the "Shrink Selection" dialog. Nicer spacings for the query and message boxes. * app/ink.c: tried to grab the pointer in the blob preview but failed. Left the code there as a reminder (commented out). * app/menus.c: reordered <Image>/Select. I was bored and grep-ed the sources for ancient or deprecated stuff: * app/about_dialog.[ch] * app/actionarea.[ch] * app/app_procs.c * app/brush_edit.c * app/brush_select.c * app/color_select.c * app/convert.c * app/devices.c * app/gdisplay.c * app/gdisplay_ops.c * app/histogram_tool.[ch] * app/info_window.c * app/install.c * app/ops_buttons.c * app/palette.c * app/palette_select.c * app/paths_dialog.c * app/pattern_select.c * app/resize.c * app/scale_toolc.c * app/text_tool.c: s/container_border_width/container_set_border_width/g, s/sprintf/g_snprintf/g, replaced some constant string lengths with strlen(x). * app/bezier_select.c * app/blend.c * app/boundary.c * app/errors.[ch] * app/free_select.c * app/gimpbrushlist.c * app/gimprc.c * app/iscissors.c * app/main.c * app/patterns.[ch] * app/text_tool.c: namespace fanaticism: prefixed all gimp error functions with "gimp_" and formated the messages more uniformly. * app/gradient.c * app/gradient_select.c: same stuff as above for the ui code. There are still some sub-dialogs which need cleanup. Did some cleanup in most of these files: prototypes, removed tons of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
gtk_widget_show (frame);
2011-09-30 11:29:11 +02:00
vbox = gtk_box_new (GTK_ORIENTATION_VERTICAL, 0);
gtk_container_add (GTK_CONTAINER (frame), vbox);
gtk_widget_show (vbox);
new ui for the "Layer Offset" dialog. 1999-07-22 Michael Natterer <mitschel@cs.tu-berlin.de> * app/channel_ops.[ch]: new ui for the "Layer Offset" dialog. * app/channels_dialog.c * app/layers_dialog.c: major code cleanup: Folded some callbacks into common ones, "widget" instead of "w", indentation, ... * app/commands.c * app/interface.[ch] * app/global_edit.c: the query boxes must be shown by the caller now. There's no need to split up the string for the message box manually as the Gtk 1.2 label widget handles newlines corectly. Added the "edge_lock" toggle to the "Shrink Selection" dialog. Nicer spacings for the query and message boxes. * app/ink.c: tried to grab the pointer in the blob preview but failed. Left the code there as a reminder (commented out). * app/menus.c: reordered <Image>/Select. I was bored and grep-ed the sources for ancient or deprecated stuff: * app/about_dialog.[ch] * app/actionarea.[ch] * app/app_procs.c * app/brush_edit.c * app/brush_select.c * app/color_select.c * app/convert.c * app/devices.c * app/gdisplay.c * app/gdisplay_ops.c * app/histogram_tool.[ch] * app/info_window.c * app/install.c * app/ops_buttons.c * app/palette.c * app/palette_select.c * app/paths_dialog.c * app/pattern_select.c * app/resize.c * app/scale_toolc.c * app/text_tool.c: s/container_border_width/container_set_border_width/g, s/sprintf/g_snprintf/g, replaced some constant string lengths with strlen(x). * app/bezier_select.c * app/blend.c * app/boundary.c * app/errors.[ch] * app/free_select.c * app/gimpbrushlist.c * app/gimprc.c * app/iscissors.c * app/main.c * app/patterns.[ch] * app/text_tool.c: namespace fanaticism: prefixed all gimp error functions with "gimp_" and formated the messages more uniformly. * app/gradient.c * app/gradient_select.c: same stuff as above for the ui code. There are still some sub-dialogs which need cleanup. Did some cleanup in most of these files: prototypes, removed tons of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
data_editor->view = gimp_view_new_full_by_types (NULL,
GIMP_TYPE_VIEW,
GIMP_TYPE_GRADIENT,
GRAD_VIEW_SIZE,
GRAD_VIEW_SIZE, 0,
FALSE, FALSE, FALSE);
gtk_widget_set_size_request (data_editor->view, -1, GRAD_VIEW_SIZE);
gtk_widget_set_events (data_editor->view, GRAD_VIEW_EVENT_MASK);
gimp_view_set_expand (GIMP_VIEW (data_editor->view), TRUE);
gtk_box_pack_start (GTK_BOX (vbox), data_editor->view, TRUE, TRUE, 0);
gtk_widget_show (data_editor->view);
g_signal_connect (data_editor->view, "event",
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
G_CALLBACK (view_events),
editor);
1999-10-28 15:05:49 +00:00
gimp_dnd_viewable_dest_add (GTK_WIDGET (data_editor->view),
GIMP_TYPE_GRADIENT,
gradient_editor_drop_gradient,
editor);
1999-10-28 15:05:49 +00:00
gimp_dnd_color_dest_add (GTK_WIDGET (data_editor->view),
gradient_editor_drop_color,
editor);
editor->zoom_gesture = gtk_gesture_zoom_new (GTK_WIDGET (data_editor->view));
gtk_event_controller_set_propagation_phase (GTK_EVENT_CONTROLLER (editor->zoom_gesture),
GTK_PHASE_CAPTURE);
g_signal_connect (editor->zoom_gesture, "begin",
G_CALLBACK (view_zoom_gesture_begin),
editor);
g_signal_connect (editor->zoom_gesture, "update",
G_CALLBACK (view_zoom_gesture_update),
editor);
new ui for the "Layer Offset" dialog. 1999-07-22 Michael Natterer <mitschel@cs.tu-berlin.de> * app/channel_ops.[ch]: new ui for the "Layer Offset" dialog. * app/channels_dialog.c * app/layers_dialog.c: major code cleanup: Folded some callbacks into common ones, "widget" instead of "w", indentation, ... * app/commands.c * app/interface.[ch] * app/global_edit.c: the query boxes must be shown by the caller now. There's no need to split up the string for the message box manually as the Gtk 1.2 label widget handles newlines corectly. Added the "edge_lock" toggle to the "Shrink Selection" dialog. Nicer spacings for the query and message boxes. * app/ink.c: tried to grab the pointer in the blob preview but failed. Left the code there as a reminder (commented out). * app/menus.c: reordered <Image>/Select. I was bored and grep-ed the sources for ancient or deprecated stuff: * app/about_dialog.[ch] * app/actionarea.[ch] * app/app_procs.c * app/brush_edit.c * app/brush_select.c * app/color_select.c * app/convert.c * app/devices.c * app/gdisplay.c * app/gdisplay_ops.c * app/histogram_tool.[ch] * app/info_window.c * app/install.c * app/ops_buttons.c * app/palette.c * app/palette_select.c * app/paths_dialog.c * app/pattern_select.c * app/resize.c * app/scale_toolc.c * app/text_tool.c: s/container_border_width/container_set_border_width/g, s/sprintf/g_snprintf/g, replaced some constant string lengths with strlen(x). * app/bezier_select.c * app/blend.c * app/boundary.c * app/errors.[ch] * app/free_select.c * app/gimpbrushlist.c * app/gimprc.c * app/iscissors.c * app/main.c * app/patterns.[ch] * app/text_tool.c: namespace fanaticism: prefixed all gimp error functions with "gimp_" and formated the messages more uniformly. * app/gradient.c * app/gradient_select.c: same stuff as above for the ui code. There are still some sub-dialogs which need cleanup. Did some cleanup in most of these files: prototypes, removed tons of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
/* Gradient control */
editor->control = gtk_drawing_area_new ();
gtk_widget_set_size_request (editor->control, -1, GRAD_CONTROL_HEIGHT);
gtk_widget_set_events (editor->control, GRAD_CONTROL_EVENT_MASK);
gtk_box_pack_start (GTK_BOX (vbox), editor->control, FALSE, FALSE, 0);
gtk_widget_show (editor->control);
new ui for the "Layer Offset" dialog. 1999-07-22 Michael Natterer <mitschel@cs.tu-berlin.de> * app/channel_ops.[ch]: new ui for the "Layer Offset" dialog. * app/channels_dialog.c * app/layers_dialog.c: major code cleanup: Folded some callbacks into common ones, "widget" instead of "w", indentation, ... * app/commands.c * app/interface.[ch] * app/global_edit.c: the query boxes must be shown by the caller now. There's no need to split up the string for the message box manually as the Gtk 1.2 label widget handles newlines corectly. Added the "edge_lock" toggle to the "Shrink Selection" dialog. Nicer spacings for the query and message boxes. * app/ink.c: tried to grab the pointer in the blob preview but failed. Left the code there as a reminder (commented out). * app/menus.c: reordered <Image>/Select. I was bored and grep-ed the sources for ancient or deprecated stuff: * app/about_dialog.[ch] * app/actionarea.[ch] * app/app_procs.c * app/brush_edit.c * app/brush_select.c * app/color_select.c * app/convert.c * app/devices.c * app/gdisplay.c * app/gdisplay_ops.c * app/histogram_tool.[ch] * app/info_window.c * app/install.c * app/ops_buttons.c * app/palette.c * app/palette_select.c * app/paths_dialog.c * app/pattern_select.c * app/resize.c * app/scale_toolc.c * app/text_tool.c: s/container_border_width/container_set_border_width/g, s/sprintf/g_snprintf/g, replaced some constant string lengths with strlen(x). * app/bezier_select.c * app/blend.c * app/boundary.c * app/errors.[ch] * app/free_select.c * app/gimpbrushlist.c * app/gimprc.c * app/iscissors.c * app/main.c * app/patterns.[ch] * app/text_tool.c: namespace fanaticism: prefixed all gimp error functions with "gimp_" and formated the messages more uniformly. * app/gradient.c * app/gradient_select.c: same stuff as above for the ui code. There are still some sub-dialogs which need cleanup. Did some cleanup in most of these files: prototypes, removed tons of #include's, i18n fixes, s/w/widget/ as above, indentation, ...
1999-07-22 16:21:10 +00:00
g_signal_connect (editor->control, "event",
G_CALLBACK (control_events),
editor);
g_signal_connect (editor->control, "draw",
G_CALLBACK (control_draw),
editor);
gimp_dnd_color_dest_add (GTK_WIDGET (editor->control),
gradient_editor_control_drop_color,
editor);
/* Scrollbar */
editor->zoom_factor = 1;
editor->scroll_data = gtk_adjustment_new (0.0, 0.0, 1.0,
GRAD_SCROLLBAR_STEP_SIZE,
GRAD_SCROLLBAR_PAGE_SIZE,
1.0);
g_signal_connect (editor->scroll_data, "value-changed",
G_CALLBACK (gradient_editor_scrollbar_update),
editor);
g_signal_connect (editor->scroll_data, "changed",
G_CALLBACK (gradient_editor_scrollbar_update),
editor);
editor->scrollbar = gtk_scrollbar_new (GTK_ORIENTATION_HORIZONTAL,
editor->scroll_data);
gtk_box_pack_start (GTK_BOX (editor), editor->scrollbar, FALSE, FALSE, 0);
gtk_widget_show (editor->scrollbar);
/* Box for current color and the hint labels */
2011-09-30 11:29:11 +02:00
hbox = gtk_box_new (GTK_ORIENTATION_HORIZONTAL, 2);
gtk_box_pack_start (GTK_BOX (editor), hbox, FALSE, FALSE, 0);
gtk_widget_show (hbox);
/* Frame showing current active color */
frame = gtk_frame_new (NULL);
gtk_frame_set_shadow_type (GTK_FRAME (frame), GTK_SHADOW_IN);
gtk_box_pack_start (GTK_BOX (hbox), frame, FALSE, FALSE, 0);
gtk_widget_show (frame);
editor->current_color = gimp_color_area_new (&transp,
GIMP_COLOR_AREA_SMALL_CHECKS,
GDK_BUTTON1_MASK |
GDK_BUTTON2_MASK);
gtk_container_add (GTK_CONTAINER (frame), editor->current_color);
gtk_widget_set_size_request (editor->current_color,
GRAD_CURRENT_COLOR_WIDTH, -1);
gtk_widget_show (editor->current_color);
/* Hint box */
2011-09-30 11:29:11 +02:00
hint_vbox = gtk_box_new (GTK_ORIENTATION_VERTICAL, 0);
gtk_box_pack_start (GTK_BOX (hbox), hint_vbox, TRUE, TRUE, 0);
gtk_widget_show (hint_vbox);
editor->hint_label1 = gradient_hint_label_add (GTK_BOX (hint_vbox));
editor->hint_label2 = gradient_hint_label_add (GTK_BOX (hint_vbox));
editor->hint_label3 = gradient_hint_label_add (GTK_BOX (hint_vbox));
editor->hint_label4 = gradient_hint_label_add (GTK_BOX (hint_vbox));
2003-03-10 14:07:22 +00:00
/* Black, 50% Gray, White, Clear */
gimp_rgba_set (&editor->saved_colors[0], 0.0, 0.0, 0.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[1], 0.5, 0.5, 0.5, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[2], 1.0, 1.0, 1.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[3], 0.0, 0.0, 0.0, GIMP_OPACITY_TRANSPARENT);
/* Red, Yellow, Green, Cyan, Blue, Magenta */
gimp_rgba_set (&editor->saved_colors[4], 1.0, 0.0, 0.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[5], 1.0, 1.0, 0.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[6], 0.0, 1.0, 0.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[7], 0.0, 1.0, 1.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[8], 0.0, 0.0, 1.0, GIMP_OPACITY_OPAQUE);
gimp_rgba_set (&editor->saved_colors[9], 1.0, 0.0, 1.0, GIMP_OPACITY_OPAQUE);
1999-10-28 15:05:49 +00:00
}
static void
gimp_gradient_editor_constructed (GObject *object)
{
GimpGradientEditor *editor = GIMP_GRADIENT_EDITOR (object);
G_OBJECT_CLASS (parent_class)->constructed (object);
gimp_editor_add_action_button (GIMP_EDITOR (editor), "gradient-editor",
"gradient-editor-zoom-out", NULL);
gimp_editor_add_action_button (GIMP_EDITOR (editor), "gradient-editor",
"gradient-editor-zoom-in", NULL);
gimp_editor_add_action_button (GIMP_EDITOR (editor), "gradient-editor",
"gradient-editor-zoom-all", NULL);
}
static void
gimp_gradient_editor_dispose (GObject *object)
{
GimpGradientEditor *editor = GIMP_GRADIENT_EDITOR (object);
if (editor->color_dialog)
gtk_dialog_response (GTK_DIALOG (editor->color_dialog),
GTK_RESPONSE_CANCEL);
g_clear_object (&editor->zoom_gesture);
G_OBJECT_CLASS (parent_class)->dispose (object);
}
static void
gimp_gradient_editor_unmap (GtkWidget *widget)
{
GimpGradientEditor *editor = GIMP_GRADIENT_EDITOR (widget);
if (editor->color_dialog)
gtk_dialog_response (GTK_DIALOG (editor->color_dialog),
GTK_RESPONSE_CANCEL);
GTK_WIDGET_CLASS (parent_class)->unmap (widget);
}
static void
gimp_gradient_editor_set_data (GimpDataEditor *editor,
GimpData *data)
1997-11-24 22:05:25 +00:00
{
added action_data_get_context() and macro return_if_no_context(). 2004-05-11 Michael Natterer <mitch@gimp.org> * app/actions/actions.[ch]: added action_data_get_context() and macro return_if_no_context(). * app/actions/brushes-actions.c * app/actions/buffers-actions.c * app/actions/buffers-commands.c * app/actions/data-commands.c * app/actions/fonts-actions.c * app/actions/fonts-commands.c * app/actions/gradients-actions.c * app/actions/images-actions.c * app/actions/images-commands.c * app/actions/palettes-actions.c * app/actions/patterns-actions.c * app/actions/templates-actions.c * app/actions/templates-commands.[ch] * app/actions/tools-actions.c * app/actions/tools-commands.c: moved lots of code from widgets/ to the resp. action callbacks. * app/widgets/gimpeditor.[ch]: added gimp_editor_add_action_button() which creates a GtkButton connected to the resp. action. * app/widgets/gimpdatafactoryview.[ch]: added "action_group" parameters so we can distinguish brushes, patterns etc. actions. * app/widgets/gimpimageview.[ch] * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbufferview.c * app/widgets/gimpfontview.c * app/widgets/gimpgradienteditor.c * app/widgets/gimppatternfactoryview.c * app/widgets/gimptemplateview.[ch] * app/widgets/gimptoolview.c: removed tons of GtkButton::clicked() callbacks and use gimp_editor_add_action_button() instead of simply _add_button(). * app/gui/dialogs-constructors.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: changed accordingly.
2004-05-11 16:05:21 +00:00
GimpGradientEditor *gradient_editor = GIMP_GRADIENT_EDITOR (editor);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
GimpData *old_data;
if (gradient_editor->color_dialog)
gtk_dialog_response (GTK_DIALOG (gradient_editor->color_dialog),
GTK_RESPONSE_CANCEL);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
old_data = gimp_data_editor_get_data (editor);
if (old_data)
g_signal_handlers_disconnect_by_func (old_data,
gimp_gradient_editor_gradient_dirty,
gradient_editor);
GIMP_DATA_EDITOR_CLASS (parent_class)->set_data (editor, data);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
if (data)
g_signal_connect_swapped (data, "dirty",
G_CALLBACK (gimp_gradient_editor_gradient_dirty),
gradient_editor);
gimp_view_set_viewable (GIMP_VIEW (editor->view),
GIMP_VIEWABLE (data));
2003-03-10 14:07:22 +00:00
control_update (gradient_editor, GIMP_GRADIENT (data), TRUE);
}
1997-11-24 22:05:25 +00:00
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
static void
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
gimp_gradient_editor_set_context (GimpDocked *docked,
GimpContext *context)
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (docked);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
parent_docked_iface->set_context (docked, context);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gimp_view_renderer_set_context (GIMP_VIEW (data_editor->view)->renderer,
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
context);
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
}
/* public functions */
GtkWidget *
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
gimp_gradient_editor_new (GimpContext *context,
Move away from creating all item_factories statically in menus_init() but 2003-01-10 Michael Natterer <mitch@gimp.org> Move away from creating all item_factories statically in menus_init() but create a new one for each place where one is needed: * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpmenufactory.[ch]: new factory which creates and configures the GimpItemFactories it knows about on-the-fly. * app/widgets/gimpitemfactory.[ch]: added gimp_item_factory_update() which calls the "update_func". Added "gboolean update_on_popup" so item_factories can be configured to require manual updates (used for the <Image> factory). * app/gui/menus.[ch]: create a "global_menu_factory" and register all menus we have with it. Added various setup functions which do stuff like adding the "Open Recent" menu or reorder plug-in menu entries. Removed the debugging stuff... * app/gui/Makefile.am * app/gui/debug-commands.[ch]: ...and added it here. * app/gui/gui.c: create the <Toolbox>, the popup-<Image> and the <Paths> factories here because they are still global. * app/gui/plug-in-menus.[ch]: changed the "image_factory" parameters to "item_factory" and create/update the entries for the passed item_factory only. Makes the whole stuff much more straightforward. * app/plug-in/plug-ins.c: don't call plug_in_make_menu(). * app/display/gimpdisplay.[ch] * app/display/gimpdisplayshell.[ch]: added "menu_factory" and "popup_factory" parameters to gimp_display_new() and gimp_display_shell_new(). Create the menubar_factory and the qmask_factory dynamically. Pass the shell, not a Gimp to the QMask callbacks. Changed gimp_display_shell_set_menu_sensitivity() to gimp_display_shell_menu_update() and don't call it directly (it's a GimpItemFactory update_func now). Call gimp_item_factory_update() on the resp. factories instead. * app/gui/qmask-commands.c * app/display/gimpdisplayshell-callbacks.c * app/tools/gimpimagemaptool.c: changed accordingly. * app/widgets/gimpbrusheditor.c * app/widgets/gimpbrushfactoryview.[ch] * app/widgets/gimpbufferview.[ch] * app/widgets/gimpcolormapeditor.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdock.c * app/widgets/gimpdockbook.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemlistview.[ch] * app/widgets/gimppaletteeditor.[ch]: pass around lots of GimpMenuFactory pointers and menu_identifiers so all views can create their item_factories themselves. Unref the factories when they are no longer needed because they belong to the views now. * app/gui/dialogs-commands.c * app/gui/dialogs-constructors.c * app/gui/dialogs.c * app/gui/brush-select.c * app/gui/gradient-select.c * app/gui/palette-select.c * app/gui/pattern-select.c: changed accordingly. * app/gui/file-dialog-utils.[ch] (file_dialog_new): require menu_factory and menu_identifier parameters. * app/gui/file-open-dialog.[ch] * app/gui/file-save-dialog.[ch]: removed file_*_dialog_menu_init() (they went to menus.c as setup_funcs). Added file_*_dialog_set_type() and moved the <Load> and <Save> factory callbacks to file-commands.c * app/gui/file-commands.[ch]: changed accordingly. * app/gui/view-commands.c: changed the statusbar, menubar, rulers and guides callbacks to do their job only if the setting has actually changed. Don't update whole item factories afterwards. Instead, just change the state of the items that actually need update. Unrelated: * app/core/gimpchannel.c (gimp_channel_init): set "bounds_known" and friends to FALSE since we don't know that the new channel will be empty (fixes QMask and probably other stuff). * app/gui/image-commands.c * app/gui/vectors-commands.c: cleanup.
2003-01-10 17:55:53 +00:00
GimpMenuFactory *menu_factory)
{
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
g_return_val_if_fail (GIMP_IS_CONTEXT (context), NULL);
return g_object_new (GIMP_TYPE_GRADIENT_EDITOR,
"menu-factory", menu_factory,
"menu-identifier", "<GradientEditor>",
"ui-path", "/gradient-editor-popup",
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
"data-factory", context->gimp->gradient_factory,
"context", context,
"data", gimp_context_get_gradient (context),
NULL);
}
1997-11-24 22:05:25 +00:00
void
gimp_gradient_editor_get_selection (GimpGradientEditor *editor,
GimpGradient **gradient,
GimpGradientSegment **left,
GimpGradientSegment **right)
{
g_return_if_fail (GIMP_IS_GRADIENT_EDITOR (editor));
if (gradient)
*gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
if (left)
*left = editor->control_sel_l;
if (right)
*right = editor->control_sel_r;
}
void
gimp_gradient_editor_set_selection (GimpGradientEditor *editor,
GimpGradientSegment *left,
GimpGradientSegment *right)
{
g_return_if_fail (GIMP_IS_GRADIENT_EDITOR (editor));
g_return_if_fail (left != NULL);
g_return_if_fail (right != NULL);
editor->control_sel_l = left;
editor->control_sel_r = right;
}
void
gimp_gradient_editor_edit_left_color (GimpGradientEditor *editor)
{
GimpGradient *gradient;
g_return_if_fail (GIMP_IS_GRADIENT_EDITOR (editor));
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
if (! gradient ||
! editor->control_sel_l ||
editor->control_sel_l->left_color_type != GIMP_GRADIENT_COLOR_FIXED)
return;
editor->saved_dirty = gimp_data_is_dirty (GIMP_DATA (gradient));
editor->saved_segments = gradient_editor_save_selection (editor);
editor->color_dialog =
gimp_color_dialog_new (GIMP_VIEWABLE (gradient),
GIMP_DATA_EDITOR (editor)->context,
TRUE,
_("Left Endpoint Color"),
GIMP_ICON_GRADIENT,
_("Gradient Segment's Left Endpoint Color"),
GTK_WIDGET (editor),
gimp_dialog_factory_get_singleton (),
"gimp-gradient-editor-color-dialog",
&editor->control_sel_l->left_color,
TRUE, TRUE);
g_signal_connect (editor->color_dialog, "destroy",
G_CALLBACK (gtk_widget_destroyed),
&editor->color_dialog);
g_signal_connect (editor->color_dialog, "update",
G_CALLBACK (gradient_editor_left_color_update),
editor);
gtk_widget_set_sensitive (GTK_WIDGET (editor), FALSE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
gtk_window_present (GTK_WINDOW (editor->color_dialog));
}
void
gimp_gradient_editor_edit_right_color (GimpGradientEditor *editor)
{
GimpGradient *gradient;
g_return_if_fail (GIMP_IS_GRADIENT_EDITOR (editor));
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
if (! gradient ||
! editor->control_sel_r ||
editor->control_sel_r->right_color_type != GIMP_GRADIENT_COLOR_FIXED)
return;
editor->saved_dirty = gimp_data_is_dirty (GIMP_DATA (gradient));
editor->saved_segments = gradient_editor_save_selection (editor);
editor->color_dialog =
gimp_color_dialog_new (GIMP_VIEWABLE (gradient),
GIMP_DATA_EDITOR (editor)->context,
TRUE,
_("Right Endpoint Color"),
GIMP_ICON_GRADIENT,
_("Gradient Segment's Right Endpoint Color"),
GTK_WIDGET (editor),
gimp_dialog_factory_get_singleton (),
"gimp-gradient-editor-color-dialog",
&editor->control_sel_l->right_color,
TRUE, TRUE);
g_signal_connect (editor->color_dialog, "destroy",
G_CALLBACK (gtk_widget_destroyed),
&editor->color_dialog);
g_signal_connect (editor->color_dialog, "update",
G_CALLBACK (gradient_editor_right_color_update),
editor);
gtk_widget_set_sensitive (GTK_WIDGET (editor), FALSE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
gtk_window_present (GTK_WINDOW (editor->color_dialog));
}
void
gimp_gradient_editor_zoom (GimpGradientEditor *editor,
GimpZoomType zoom_type,
gdouble delta,
gdouble zoom_focus_x)
{
GtkAdjustment *adjustment;
gdouble old_value;
gdouble old_page_size;
gdouble value = 0.0;
gdouble page_size = 1.0;
g_return_if_fail (GIMP_IS_GRADIENT_EDITOR (editor));
if (zoom_type == GIMP_ZOOM_SMOOTH)
{
if (delta < 0)
zoom_type = GIMP_ZOOM_IN;
else if (delta > 0)
zoom_type = GIMP_ZOOM_OUT;
else
return;
delta = ABS (delta);
}
else if (zoom_type != GIMP_ZOOM_PINCH)
{
delta = 1.0;
}
adjustment = editor->scroll_data;
old_value = gtk_adjustment_get_value (adjustment);
old_page_size = gtk_adjustment_get_page_size (adjustment);
switch (zoom_type)
{
case GIMP_ZOOM_IN_MAX:
case GIMP_ZOOM_IN_MORE:
case GIMP_ZOOM_IN:
editor->zoom_factor += delta;
page_size = 1.0 / editor->zoom_factor;
value = old_value + (old_page_size - page_size) * zoom_focus_x;
break;
case GIMP_ZOOM_OUT_MORE:
case GIMP_ZOOM_OUT:
editor->zoom_factor -= delta;
if (editor->zoom_factor < 1)
editor->zoom_factor = 1;
page_size = 1.0 / editor->zoom_factor;
value = old_value - (page_size - old_page_size) * zoom_focus_x;
if (value < 0.0)
value = 0.0;
else if ((value + page_size) > 1.0)
value = 1.0 - page_size;
break;
case GIMP_ZOOM_OUT_MAX:
case GIMP_ZOOM_TO: /* abused as ZOOM_ALL */
editor->zoom_factor = 1;
value = 0.0;
page_size = 1.0;
break;
case GIMP_ZOOM_PINCH:
if (delta > 0.0)
editor->zoom_factor = editor->zoom_factor * (1.0 + delta);
else if (delta < 0.0)
editor->zoom_factor = editor->zoom_factor / (1.0 + -delta);
else
return;
if (editor->zoom_factor < 1)
editor->zoom_factor = 1;
page_size = 1.0 / editor->zoom_factor;
value = old_value + (old_page_size - page_size) * zoom_focus_x;
if (value < 0.0)
value = 0.0;
else if ((value + page_size) > 1.0)
value = 1.0 - page_size;
break;
case GIMP_ZOOM_SMOOTH: /* can't happen, see above switch() */
break;
}
gtk_adjustment_configure (adjustment,
value,
gtk_adjustment_get_lower (adjustment),
gtk_adjustment_get_upper (adjustment),
page_size * GRAD_SCROLLBAR_STEP_SIZE,
page_size * GRAD_SCROLLBAR_PAGE_SIZE,
page_size);
}
/* private functions */
1997-11-24 22:05:25 +00:00
static void
gimp_gradient_editor_update (GimpGradientEditor *editor)
{
GimpGradient *gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
control_update (editor, gradient, FALSE);
}
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
static void
gimp_gradient_editor_gradient_dirty (GimpGradientEditor *editor,
GimpGradient *gradient)
{
GimpGradientSegment *segment;
gboolean left_seen = FALSE;
gboolean right_seen = FALSE;
for (segment = gradient->segments; segment; segment = segment->next)
{
if (segment == editor->control_sel_l)
left_seen = TRUE;
if (segment == editor->control_sel_r)
right_seen = TRUE;
if (right_seen && ! left_seen)
{
GimpGradientSegment *tmp;
tmp = editor->control_sel_l;
editor->control_sel_l = editor->control_sel_r;
editor->control_sel_r = tmp;
right_seen = FALSE;
left_seen = TRUE;
}
}
control_update (editor, gradient, ! (left_seen && right_seen));
}
1997-11-24 22:05:25 +00:00
static void
gradient_editor_drop_gradient (GtkWidget *widget,
gint x,
gint y,
GimpViewable *viewable,
gpointer data)
1997-11-24 22:05:25 +00:00
{
gimp_data_editor_set_data (GIMP_DATA_EDITOR (data), GIMP_DATA (viewable));
}
1997-11-24 22:05:25 +00:00
static void
gradient_editor_drop_color (GtkWidget *widget,
gint x,
gint y,
const GimpRGB *color,
gpointer data)
{
GimpGradientEditor *editor = GIMP_GRADIENT_EDITOR (data);
GimpGradient *gradient;
gdouble xpos;
GimpGradientSegment *seg, *lseg, *rseg;
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
xpos = control_calc_g_pos (editor, x);
seg = gimp_gradient_get_segment_at (gradient, xpos);
gimp_data_freeze (GIMP_DATA (gradient));
gimp_gradient_segment_split_midpoint (gradient,
GIMP_DATA_EDITOR (editor)->context,
seg,
editor->blend_color_space,
&lseg, &rseg);
if (lseg)
{
lseg->right = xpos;
lseg->middle = (lseg->left + lseg->right) / 2.0;
lseg->right_color = *color;
}
if (rseg)
{
rseg->left = xpos;
rseg->middle = (rseg->left + rseg->right) / 2.0;
rseg->left_color = *color;
}
gimp_data_thaw (GIMP_DATA (gradient));
}
static void
gradient_editor_control_drop_color (GtkWidget *widget,
gint x,
gint y,
const GimpRGB *color,
gpointer data)
{
GimpGradientEditor *editor = GIMP_GRADIENT_EDITOR (data);
GimpGradient *gradient;
gdouble xpos;
GimpGradientSegment *seg, *lseg, *rseg;
GradientEditorDragMode handle;
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
xpos = control_calc_g_pos (editor, x);
seg_get_closest_handle (gradient, xpos, &seg, &handle);
if (seg)
{
if (handle == GRAD_DRAG_LEFT)
{
lseg = seg->prev;
rseg = seg;
}
else
return;
}
else
{
lseg = gimp_gradient_get_segment_at (gradient, xpos);
rseg = NULL;
}
gimp_data_freeze (GIMP_DATA (gradient));
if (lseg)
lseg->right_color = *color;
if (rseg)
rseg->left_color = *color;
gimp_data_thaw (GIMP_DATA (gradient));
}
1997-11-24 22:05:25 +00:00
static void
gradient_editor_scrollbar_update (GtkAdjustment *adjustment,
GimpGradientEditor *editor)
1997-11-24 22:05:25 +00:00
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (editor);
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
GimpViewRendererGradient *renderer;
gchar *str1;
gchar *str2;
str1 = g_strdup_printf (_("Zoom factor: %f:1"),
editor->zoom_factor);
1997-11-24 22:05:25 +00:00
str2 = g_strdup_printf (_("Displaying [%0.4f, %0.4f]"),
gtk_adjustment_get_value (adjustment),
gtk_adjustment_get_value (adjustment) +
app/widgets/gimpblobeditor.c app/widgets/gimpbrushselect.c 2009-03-22 Michael Natterer <mitch@gimp.org> * app/widgets/gimpblobeditor.c * app/widgets/gimpbrushselect.c * app/widgets/gimpcolorbar.c * app/widgets/gimpcolordialog.c * app/widgets/gimpcolorframe.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontrollereditor.c * app/widgets/gimpcontrollerlist.c * app/widgets/gimpcursor.c * app/widgets/gimpcurveview.c * app/widgets/gimpdasheditor.c * app/widgets/gimpdialogfactory.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpdockable.c * app/widgets/gimperrordialog.c * app/widgets/gimpfgbgeditor.c * app/widgets/gimpfgbgview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpgradientselect.c * app/widgets/gimphandlebar.c * app/widgets/gimphistogrambox.c * app/widgets/gimphistogramview.c * app/widgets/gimpmessagedialog.c * app/widgets/gimpnavigationview.c * app/widgets/gimppaletteselect.c * app/widgets/gimppaletteview.c * app/widgets/gimppatternselect.c * app/widgets/gimpprogressbox.c * app/widgets/gimpprogressdialog.c * app/widgets/gimpscalebutton.c * app/widgets/gimpselectiondata.c * app/widgets/gimpsessioninfo.c * app/widgets/gimpsettingsbox.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptexteditor.c * app/widgets/gimptoolbox.c * app/widgets/gimpuimanager.c * app/widgets/gimpview-popup.c * app/widgets/gimpview.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpwidgets-utils.c: use accessors for various members of GTK+ structures that don't exist any longer when GSEAL_ENABLE is defined. svn path=/trunk/; revision=28193
2009-03-22 16:35:53 +00:00
gtk_adjustment_get_page_size (adjustment));
1997-11-24 22:05:25 +00:00
gradient_editor_set_hint (editor, str1, str2, NULL, NULL);
1997-11-24 22:05:25 +00:00
g_free (str1);
g_free (str2);
renderer = GIMP_VIEW_RENDERER_GRADIENT (GIMP_VIEW (data_editor->view)->renderer);
2003-03-10 14:07:22 +00:00
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
gimp_view_renderer_gradient_set_offsets (renderer,
gtk_adjustment_get_value (adjustment),
gtk_adjustment_get_value (adjustment) +
gtk_adjustment_get_page_size (adjustment));
1997-11-24 22:05:25 +00:00
gimp_view_renderer_update (GIMP_VIEW_RENDERER (renderer));
gimp_gradient_editor_update (editor);
}
1997-11-24 22:05:25 +00:00
static void
gradient_editor_set_hint (GimpGradientEditor *editor,
const gchar *str1,
const gchar *str2,
const gchar *str3,
const gchar *str4)
{
gtk_label_set_text (GTK_LABEL (editor->hint_label1), str1);
gtk_label_set_text (GTK_LABEL (editor->hint_label2), str2);
gtk_label_set_text (GTK_LABEL (editor->hint_label3), str3);
gtk_label_set_text (GTK_LABEL (editor->hint_label4), str4);
}
static GimpGradientSegment *
gradient_editor_save_selection (GimpGradientEditor *editor)
{
GimpGradientSegment *seg, *prev, *tmp;
GimpGradientSegment *oseg, *oaseg;
prev = NULL;
oseg = editor->control_sel_l;
tmp = NULL;
do
{
seg = gimp_gradient_segment_new ();
*seg = *oseg; /* Copy everything */
if (prev == NULL)
tmp = seg; /* Remember first segment */
else
prev->next = seg;
seg->prev = prev;
seg->next = NULL;
prev = seg;
oaseg = oseg;
oseg = oseg->next;
}
while (oaseg != editor->control_sel_r);
return tmp;
}
static void
gradient_editor_replace_selection (GimpGradientEditor *editor,
GimpGradientSegment *replace_seg)
{
GimpGradient *gradient;
GimpGradientSegment *lseg, *rseg;
GimpGradientSegment *replace_last;
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
/* Remember left and right segments */
lseg = editor->control_sel_l->prev;
rseg = editor->control_sel_r->next;
replace_last = gimp_gradient_segment_get_last (replace_seg);
/* Free old selection */
editor->control_sel_r->next = NULL;
gimp_gradient_segments_free (editor->control_sel_l);
/* Link in new segments */
if (lseg)
lseg->next = replace_seg;
else
gradient->segments = replace_seg;
replace_seg->prev = lseg;
if (rseg)
rseg->prev = replace_last;
replace_last->next = rseg;
editor->control_sel_l = replace_seg;
editor->control_sel_r = replace_last;
}
static void
gradient_editor_left_color_update (GimpColorDialog *dialog,
const GimpRGB *color,
GimpColorDialogState state,
GimpGradientEditor *editor)
{
GimpGradient *gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
switch (state)
{
case GIMP_COLOR_DIALOG_UPDATE:
gimp_gradient_segment_range_blend (gradient,
editor->control_sel_l,
editor->control_sel_r,
color,
&editor->control_sel_r->right_color,
TRUE, TRUE);
break;
case GIMP_COLOR_DIALOG_OK:
gimp_gradient_segment_range_blend (gradient,
editor->control_sel_l,
editor->control_sel_r,
color,
&editor->control_sel_r->right_color,
TRUE, TRUE);
gimp_gradient_segments_free (editor->saved_segments);
gtk_widget_destroy (editor->color_dialog);
editor->color_dialog = NULL;
gtk_widget_set_sensitive (GTK_WIDGET (editor), TRUE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
break;
case GIMP_COLOR_DIALOG_CANCEL:
gradient_editor_replace_selection (editor, editor->saved_segments);
if (! editor->saved_dirty)
gimp_data_clean (GIMP_DATA (gradient));
gimp_viewable_invalidate_preview (GIMP_VIEWABLE (gradient));
gtk_widget_destroy (editor->color_dialog);
editor->color_dialog = NULL;
gtk_widget_set_sensitive (GTK_WIDGET (editor), TRUE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
break;
}
}
static void
gradient_editor_right_color_update (GimpColorDialog *dialog,
const GimpRGB *color,
GimpColorDialogState state,
GimpGradientEditor *editor)
{
GimpGradient *gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
switch (state)
{
case GIMP_COLOR_DIALOG_UPDATE:
gimp_gradient_segment_range_blend (gradient,
editor->control_sel_l,
editor->control_sel_r,
&editor->control_sel_l->left_color,
color,
TRUE, TRUE);
break;
case GIMP_COLOR_DIALOG_OK:
gimp_gradient_segment_range_blend (gradient,
editor->control_sel_l,
editor->control_sel_r,
&editor->control_sel_l->left_color,
color,
TRUE, TRUE);
gimp_gradient_segments_free (editor->saved_segments);
gtk_widget_destroy (editor->color_dialog);
editor->color_dialog = NULL;
gtk_widget_set_sensitive (GTK_WIDGET (editor), TRUE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
break;
case GIMP_COLOR_DIALOG_CANCEL:
gradient_editor_replace_selection (editor, editor->saved_segments);
if (! editor->saved_dirty)
gimp_data_clean (GIMP_DATA (gradient));
gimp_viewable_invalidate_preview (GIMP_VIEWABLE (gradient));
gtk_widget_destroy (editor->color_dialog);
editor->color_dialog = NULL;
gtk_widget_set_sensitive (GTK_WIDGET (editor), TRUE);
gimp_ui_manager_update (gimp_editor_get_ui_manager (GIMP_EDITOR (editor)),
gimp_editor_get_popup_data (GIMP_EDITOR (editor)));
break;
}
}
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
/***** Gradient view functions *****/
1997-11-24 22:05:25 +00:00
static gboolean
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
view_events (GtkWidget *widget,
GdkEvent *event,
GimpGradientEditor *editor)
1997-11-24 22:05:25 +00:00
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (editor);
1997-11-24 22:05:25 +00:00
if (! data_editor->data)
return TRUE;
switch (event->type)
{
case GDK_LEAVE_NOTIFY:
gradient_editor_set_hint (editor, NULL, NULL, NULL, NULL);
editor->view_last_x = -1;
break;
1997-11-24 22:05:25 +00:00
case GDK_MOTION_NOTIFY:
{
GdkEventMotion *mevent = (GdkEventMotion *) event;
if (mevent->x != editor->view_last_x)
{
editor->view_last_x = mevent->x;
app/actions/dockable-actions.c app/actions/dockable-commands.[ch] 2006-01-17 Michael Natterer <mitch@gimp.org> * app/actions/dockable-actions.c * app/actions/dockable-commands.[ch] * app/dialogs/dialogs-constructors.[ch] * app/dialogs/dialogs.c * app/display/gimpdisplayshell-layer-select.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbrushfactoryview.h * app/widgets/gimpbufferview.[ch] * app/widgets/gimpchanneltreeview.c * app/widgets/gimpcomponenteditor.[ch] * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpcontainerentry.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerpopup.[ch] * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpfontview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.c * app/widgets/gimpmenudock.c * app/widgets/gimppatternfactoryview.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.[ch] * app/widgets/gimpsessioninfo.[ch] * app/widgets/gimptemplateview.[ch] * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.[ch] * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpviewablebox.c * app/widgets/gimpviewablebutton.[ch] * app/widgets/gimpviewabledialog.[ch] * app/widgets/gimpviewrenderer.c: change the word "preview" to "view" whereever we talk about GimpView or GimpViewRenderer objects or their sizes. Ther were renamed from "Preview" a long time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
if (editor->view_button_down)
{
view_pick_color (editor,
(mevent->state & gimp_get_toggle_behavior_mask ()) ?
GIMP_COLOR_PICK_TARGET_BACKGROUND :
GIMP_COLOR_PICK_TARGET_FOREGROUND,
GIMP_COLOR_PICK_STATE_UPDATE,
mevent->x);
}
else
{
view_set_hint (editor, mevent->x);
}
}
gdk_event_request_motions (mevent);
}
break;
case GDK_BUTTON_PRESS:
{
GdkEventButton *bevent = (GdkEventButton *) event;
if (gdk_event_triggers_context_menu ((GdkEvent *) bevent))
{
gimp_editor_popup_menu_at_pointer (GIMP_EDITOR (editor), event);
}
else if (bevent->button == 1)
{
editor->view_last_x = bevent->x;
app/actions/dockable-actions.c app/actions/dockable-commands.[ch] 2006-01-17 Michael Natterer <mitch@gimp.org> * app/actions/dockable-actions.c * app/actions/dockable-commands.[ch] * app/dialogs/dialogs-constructors.[ch] * app/dialogs/dialogs.c * app/display/gimpdisplayshell-layer-select.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbrushfactoryview.h * app/widgets/gimpbufferview.[ch] * app/widgets/gimpchanneltreeview.c * app/widgets/gimpcomponenteditor.[ch] * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpcontainerentry.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerpopup.[ch] * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpfontview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.c * app/widgets/gimpmenudock.c * app/widgets/gimppatternfactoryview.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.[ch] * app/widgets/gimpsessioninfo.[ch] * app/widgets/gimptemplateview.[ch] * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.[ch] * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpviewablebox.c * app/widgets/gimpviewablebutton.[ch] * app/widgets/gimpviewabledialog.[ch] * app/widgets/gimpviewrenderer.c: change the word "preview" to "view" whereever we talk about GimpView or GimpViewRenderer objects or their sizes. Ther were renamed from "Preview" a long time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
editor->view_button_down = TRUE;
view_pick_color (editor,
(bevent->state & gimp_get_toggle_behavior_mask ()) ?
GIMP_COLOR_PICK_TARGET_BACKGROUND :
GIMP_COLOR_PICK_TARGET_FOREGROUND,
GIMP_COLOR_PICK_STATE_START,
bevent->x);
}
}
break;
case GDK_SCROLL:
{
GdkEventScroll *sevent = (GdkEventScroll *) event;
if (sevent->state & gimp_get_toggle_behavior_mask ())
{
gdouble delta;
switch (sevent->direction)
{
case GDK_SCROLL_UP:
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_IN, 1.0,
view_get_normalized_last_x_pos (editor));
break;
case GDK_SCROLL_DOWN:
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_OUT, 1.0,
view_get_normalized_last_x_pos (editor));
break;
case GDK_SCROLL_SMOOTH:
gdk_event_get_scroll_deltas (event, NULL, &delta);
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_SMOOTH, delta,
view_get_normalized_last_x_pos (editor));
break;
default:
break;
}
}
else
{
gdouble value;
gimp_scroll_adjustment_values (sevent,
editor->scroll_data, NULL,
&value, NULL);
gtk_adjustment_set_value (editor->scroll_data, value);
}
}
break;
case GDK_BUTTON_RELEASE:
app/actions/dockable-actions.c app/actions/dockable-commands.[ch] 2006-01-17 Michael Natterer <mitch@gimp.org> * app/actions/dockable-actions.c * app/actions/dockable-commands.[ch] * app/dialogs/dialogs-constructors.[ch] * app/dialogs/dialogs.c * app/display/gimpdisplayshell-layer-select.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbrushfactoryview.h * app/widgets/gimpbufferview.[ch] * app/widgets/gimpchanneltreeview.c * app/widgets/gimpcomponenteditor.[ch] * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpcontainerentry.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerpopup.[ch] * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpfontview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.c * app/widgets/gimpmenudock.c * app/widgets/gimppatternfactoryview.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.[ch] * app/widgets/gimpsessioninfo.[ch] * app/widgets/gimptemplateview.[ch] * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.[ch] * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpviewablebox.c * app/widgets/gimpviewablebutton.[ch] * app/widgets/gimpviewabledialog.[ch] * app/widgets/gimpviewrenderer.c: change the word "preview" to "view" whereever we talk about GimpView or GimpViewRenderer objects or their sizes. Ther were renamed from "Preview" a long time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
if (editor->view_button_down)
{
GdkEventButton *bevent = (GdkEventButton *) event;
editor->view_last_x = bevent->x;
app/actions/dockable-actions.c app/actions/dockable-commands.[ch] 2006-01-17 Michael Natterer <mitch@gimp.org> * app/actions/dockable-actions.c * app/actions/dockable-commands.[ch] * app/dialogs/dialogs-constructors.[ch] * app/dialogs/dialogs.c * app/display/gimpdisplayshell-layer-select.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbrushfactoryview.h * app/widgets/gimpbufferview.[ch] * app/widgets/gimpchanneltreeview.c * app/widgets/gimpcomponenteditor.[ch] * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.[ch] * app/widgets/gimpcontainereditor.[ch] * app/widgets/gimpcontainerentry.[ch] * app/widgets/gimpcontainergridview.[ch] * app/widgets/gimpcontainerpopup.[ch] * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpcontainerview.[ch] * app/widgets/gimpdatafactoryview.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdialogfactory.[ch] * app/widgets/gimpdocumentview.[ch] * app/widgets/gimpfontview.[ch] * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpimageview.[ch] * app/widgets/gimpitemtreeview.[ch] * app/widgets/gimplayertreeview.c * app/widgets/gimpmenudock.c * app/widgets/gimppatternfactoryview.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.[ch] * app/widgets/gimpsessioninfo.[ch] * app/widgets/gimptemplateview.[ch] * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.[ch] * app/widgets/gimpundoeditor.[ch] * app/widgets/gimpviewablebox.c * app/widgets/gimpviewablebutton.[ch] * app/widgets/gimpviewabledialog.[ch] * app/widgets/gimpviewrenderer.c: change the word "preview" to "view" whereever we talk about GimpView or GimpViewRenderer objects or their sizes. Ther were renamed from "Preview" a long time ago and we had a preview/view naming mess ever since.
2006-01-17 10:08:50 +00:00
editor->view_button_down = FALSE;
view_pick_color (editor,
(bevent->state & gimp_get_toggle_behavior_mask ()) ?
GIMP_COLOR_PICK_TARGET_BACKGROUND :
GIMP_COLOR_PICK_TARGET_FOREGROUND,
GIMP_COLOR_PICK_STATE_END,
bevent->x);
break;
}
break;
1997-11-24 22:05:25 +00:00
default:
2003-03-10 14:07:22 +00:00
return FALSE;
}
1997-11-24 22:05:25 +00:00
return TRUE;
}
1997-11-24 22:05:25 +00:00
static void
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
view_set_hint (GimpGradientEditor *editor,
gint x)
1997-11-24 22:05:25 +00:00
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (editor);
GimpRGB rgb;
GimpHSV hsv;
gdouble xpos;
gchar *str1;
gchar *str2;
gchar *str3;
gchar *str4;
xpos = control_calc_g_pos (editor, x);
1997-11-24 22:05:25 +00:00
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
gimp_gradient_get_color_at (GIMP_GRADIENT (data_editor->data),
data_editor->context, NULL,
xpos, FALSE, FALSE, &rgb);
1997-11-24 22:05:25 +00:00
gimp_color_area_set_color (GIMP_COLOR_AREA (editor->current_color), &rgb);
gimp_rgb_to_hsv (&rgb, &hsv);
1997-11-24 22:05:25 +00:00
str1 = g_strdup_printf (_("Position: %0.4f"), xpos);
str2 = g_strdup_printf (_("RGB (%0.3f, %0.3f, %0.3f)"),
rgb.r, rgb.g, rgb.b);
str3 = g_strdup_printf (_("HSV (%0.1f, %0.1f, %0.1f)"),
hsv.h * 360.0, hsv.s * 100.0, hsv.v * 100.0);
str4 = g_strdup_printf (_("Luminance: %0.1f Opacity: %0.1f"),
GIMP_RGB_LUMINANCE (rgb.r, rgb.g, rgb.b) * 100.0,
rgb.a * 100.0);
gradient_editor_set_hint (editor, str1, str2, str3, str4);
g_free (str1);
g_free (str2);
g_free (str3);
g_free (str4);
}
1997-11-24 22:05:25 +00:00
static void
view_pick_color (GimpGradientEditor *editor,
GimpColorPickTarget pick_target,
GimpColorPickState pick_state,
gint x)
1997-11-24 22:05:25 +00:00
{
GimpDataEditor *data_editor = GIMP_DATA_EDITOR (editor);
GimpRGB color;
gdouble xpos;
gchar *str2;
gchar *str3;
xpos = control_calc_g_pos (editor, x);
1997-11-24 22:05:25 +00:00
gimp_gradient_get_color_at (GIMP_GRADIENT (data_editor->data),
data_editor->context, NULL,
xpos, FALSE, FALSE, &color);
gimp_color_area_set_color (GIMP_COLOR_AREA (editor->current_color), &color);
str2 = g_strdup_printf (_("RGB (%d, %d, %d)"),
(gint) (color.r * 255.0),
(gint) (color.g * 255.0),
(gint) (color.b * 255.0));
1997-11-24 22:05:25 +00:00
str3 = g_strdup_printf ("(%0.3f, %0.3f, %0.3f)", color.r, color.g, color.b);
1997-11-24 22:05:25 +00:00
if (pick_target == GIMP_COLOR_PICK_TARGET_FOREGROUND)
{
gimp_context_set_foreground (data_editor->context, &color);
gradient_editor_set_hint (editor, _("Foreground color set to:"),
str2, str3, NULL);
}
else
{
gimp_context_set_background (data_editor->context, &color);
gradient_editor_set_hint (editor, _("Background color set to:"),
str2, str3, NULL);
}
g_free (str2);
g_free (str3);
}
1997-11-24 22:05:25 +00:00
static void
view_zoom_gesture_begin (GtkGestureZoom *gesture,
GdkEventSequence *sequence,
GimpGradientEditor *editor)
{
editor->last_zoom_scale = gtk_gesture_zoom_get_scale_delta (gesture);
}
static void
view_zoom_gesture_update (GtkGestureZoom *gesture,
GdkEventSequence *sequence,
GimpGradientEditor *editor)
{
gdouble current_scale = gtk_gesture_zoom_get_scale_delta (gesture);
gdouble delta = (current_scale - editor->last_zoom_scale) / editor->last_zoom_scale;
editor->last_zoom_scale = current_scale;
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_PINCH, delta,
view_get_normalized_last_x_pos (editor));
}
static gdouble
view_get_normalized_last_x_pos (GimpGradientEditor *editor)
{
GtkAllocation allocation;
gdouble normalized;
if (editor->view_last_x < 0)
return 0.5;
gtk_widget_get_allocation (GIMP_DATA_EDITOR (editor)->view, &allocation);
normalized = (double) editor->view_last_x / (allocation.width - 1);
if (normalized < 0)
return 0;
if (normalized > 1.0)
return 1;
return normalized;
}
1997-11-24 22:05:25 +00:00
/***** Gradient control functions *****/
static gboolean
control_events (GtkWidget *widget,
GdkEvent *event,
GimpGradientEditor *editor)
1997-11-24 22:05:25 +00:00
{
GimpGradient *gradient;
GimpGradientSegment *seg;
if (! GIMP_DATA_EDITOR (editor)->data)
return TRUE;
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
1997-11-24 22:05:25 +00:00
switch (event->type)
{
case GDK_LEAVE_NOTIFY:
gradient_editor_set_hint (editor, NULL, NULL, NULL, NULL);
editor->control_last_x = -1;
break;
1997-11-24 22:05:25 +00:00
case GDK_BUTTON_PRESS:
if (editor->control_drag_mode == GRAD_DRAG_NONE)
{
GdkEventButton *bevent = (GdkEventButton *) event;
1997-11-24 22:05:25 +00:00
editor->control_last_x = bevent->x;
editor->control_click_time = bevent->time;
1997-11-24 22:05:25 +00:00
control_button_press (editor, bevent);
1997-11-24 22:05:25 +00:00
if (editor->control_drag_mode != GRAD_DRAG_NONE)
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
{
gtk_grab_add (widget);
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
if (GIMP_DATA_EDITOR (editor)->data_editable)
{
g_signal_handlers_block_by_func (gradient,
gimp_gradient_editor_gradient_dirty,
editor);
}
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
}
}
break;
1997-11-24 22:05:25 +00:00
2003-03-10 14:07:22 +00:00
case GDK_SCROLL:
{
GdkEventScroll *sevent = (GdkEventScroll *) event;
if (sevent->state & gimp_get_toggle_behavior_mask ())
{
gdouble delta;
switch (sevent->direction)
{
case GDK_SCROLL_UP:
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_IN, 1.0,
control_get_normalized_last_x_pos (editor));
break;
case GDK_SCROLL_DOWN:
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_OUT, 1.0,
control_get_normalized_last_x_pos (editor));
break;
case GDK_SCROLL_SMOOTH:
gdk_event_get_scroll_deltas (event, NULL, &delta);
gimp_gradient_editor_zoom (editor, GIMP_ZOOM_SMOOTH, delta,
control_get_normalized_last_x_pos (editor));
break;
default:
break;
}
}
else
{
gdouble value;
gimp_scroll_adjustment_values (sevent,
editor->scroll_data, NULL,
&value, NULL);
gtk_adjustment_set_value (editor->scroll_data, value);
}
}
2003-03-10 14:07:22 +00:00
break;
case GDK_BUTTON_RELEASE:
{
GdkEventButton *bevent = (GdkEventButton *) event;
1997-11-24 22:05:25 +00:00
gradient_editor_set_hint (editor, NULL, NULL, NULL, NULL);
1997-11-24 22:05:25 +00:00
if (editor->control_drag_mode != GRAD_DRAG_NONE)
{
if (GIMP_DATA_EDITOR (editor)->data_editable)
{
g_signal_handlers_unblock_by_func (gradient,
gimp_gradient_editor_gradient_dirty,
editor);
}
gtk_grab_remove (widget);
1997-11-24 22:05:25 +00:00
if ((bevent->time - editor->control_click_time) >= GRAD_MOVE_TIME)
{
/* stuff was done in motion */
}
else if ((editor->control_drag_mode == GRAD_DRAG_MIDDLE) ||
(editor->control_drag_mode == GRAD_DRAG_ALL))
{
seg = editor->control_drag_segment;
if ((editor->control_drag_mode == GRAD_DRAG_ALL) &&
editor->control_compress)
{
control_extend_selection (editor, seg,
control_calc_g_pos (editor,
bevent->x));
}
else
{
control_select_single_segment (editor, seg);
}
gimp_gradient_editor_update (editor);
}
1997-11-24 22:05:25 +00:00
editor->control_drag_mode = GRAD_DRAG_NONE;
editor->control_compress = FALSE;
1997-11-24 22:05:25 +00:00
control_do_hint (editor, bevent->x, bevent->y);
}
}
break;
1997-11-24 22:05:25 +00:00
case GDK_MOTION_NOTIFY:
{
GdkEventMotion *mevent = (GdkEventMotion *) event;
1997-11-24 22:05:25 +00:00
if (mevent->x != editor->control_last_x)
{
editor->control_last_x = mevent->x;
if (GIMP_DATA_EDITOR (editor)->data_editable &&
editor->control_drag_mode != GRAD_DRAG_NONE)
{
if ((mevent->time - editor->control_click_time) >= GRAD_MOVE_TIME)
control_motion (editor, gradient, mevent->x);
}
else
{
gimp_gradient_editor_update (editor);
control_do_hint (editor, mevent->x, mevent->y);
}
}
gdk_event_request_motions (mevent);
}
break;
1997-11-24 22:05:25 +00:00
default:
return FALSE;
}
1997-11-24 22:05:25 +00:00
return TRUE;
}
static gboolean
control_draw (GtkWidget *widget,
cairo_t *cr,
GimpGradientEditor *editor)
{
GtkAdjustment *adj = editor->scroll_data;
GtkAllocation allocation;
gtk_widget_get_allocation (widget, &allocation);
control_draw_all (editor,
GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data),
cr,
allocation.width,
allocation.height,
gtk_adjustment_get_value (adj),
gtk_adjustment_get_value (adj) +
gtk_adjustment_get_page_size (adj));
return TRUE;
}
1997-11-24 22:05:25 +00:00
static void
control_do_hint (GimpGradientEditor *editor,
gint x,
gint y)
1997-11-24 22:05:25 +00:00
{
GimpGradient *gradient;
GimpGradientSegment *seg;
GradientEditorDragMode handle;
gboolean in_handle;
gdouble pos;
gchar *str;
1997-11-24 22:05:25 +00:00
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
pos = control_calc_g_pos (editor, x);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if ((pos < 0.0) || (pos > 1.0))
return;
1997-11-24 22:05:25 +00:00
seg_get_closest_handle (gradient, pos, &seg, &handle);
1997-11-24 22:05:25 +00:00
in_handle = control_point_in_handle (editor, gradient,
x, y, seg, handle);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (in_handle)
{
switch (handle)
{
case GRAD_DRAG_LEFT:
if (seg != NULL)
{
if (seg->prev != NULL)
{
str = g_strdup_printf (_("%s-Drag: move & compress"),
gimp_get_mod_string (GDK_SHIFT_MASK));
gradient_editor_set_hint (editor,
NULL,
_("Drag: move"),
str,
NULL);
g_free (str);
}
else
{
str = g_strdup_printf (_("%s-Click: extend selection"),
gimp_get_mod_string (GDK_SHIFT_MASK));
gradient_editor_set_hint (editor,
NULL,
_("Click: select"),
str,
NULL);
g_free (str);
}
}
else
{
str = g_strdup_printf (_("%s-Click: extend selection"),
gimp_get_mod_string (GDK_SHIFT_MASK));
gradient_editor_set_hint (editor,
NULL,
_("Click: select"),
str,
NULL);
g_free (str);
}
break;
1997-11-24 22:05:25 +00:00
case GRAD_DRAG_MIDDLE:
str = g_strdup_printf (_("%s-Click: extend selection"),
gimp_get_mod_string (GDK_SHIFT_MASK));
gradient_editor_set_hint (editor,
NULL,
_("Click: select Drag: move"),
str,
NULL);
g_free (str);
break;
1997-11-24 22:05:25 +00:00
default:
g_warning ("%s: in_handle is true, but received handle type %d.",
G_STRFUNC, in_handle);
break;
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
else
{
gchar *str2;
str = g_strdup_printf (_("%s-Click: extend selection"),
gimp_get_mod_string (GDK_SHIFT_MASK));
str2 = g_strdup_printf (_("%s-Drag: move & compress"),
gimp_get_mod_string (GDK_SHIFT_MASK));
gradient_editor_set_hint (editor,
_("Click: select Drag: move"),
str,
str2,
NULL);
g_free (str);
g_free (str2);
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
static void
control_button_press (GimpGradientEditor *editor,
GdkEventButton *bevent)
1997-11-24 22:05:25 +00:00
{
GimpGradient *gradient;
GimpGradientSegment *seg;
GradientEditorDragMode handle;
gdouble xpos;
gboolean in_handle;
1997-11-24 22:05:25 +00:00
gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
1997-11-24 22:05:25 +00:00
if (gdk_event_triggers_context_menu ((GdkEvent *) bevent))
{
gimp_editor_popup_menu_at_pointer (GIMP_EDITOR (editor), (GdkEvent *) bevent);
return;
}
1997-11-24 22:05:25 +00:00
/* Find the closest handle */
1997-11-24 22:05:25 +00:00
xpos = control_calc_g_pos (editor, bevent->x);
1997-11-24 22:05:25 +00:00
seg_get_closest_handle (gradient, xpos, &seg, &handle);
1997-11-24 22:05:25 +00:00
in_handle = control_point_in_handle (editor, gradient, bevent->x, bevent->y, seg, handle);
1997-11-24 22:05:25 +00:00
/* Now see what we have */
1997-11-24 22:05:25 +00:00
if (in_handle)
{
switch (handle)
{
case GRAD_DRAG_LEFT:
if (seg != NULL)
{
/* Left handle of some segment */
if (bevent->state & GDK_SHIFT_MASK)
{
if (seg->prev != NULL)
{
editor->control_drag_mode = GRAD_DRAG_LEFT;
editor->control_drag_segment = seg;
editor->control_compress = TRUE;
}
else
{
control_extend_selection (editor, seg, xpos);
gimp_gradient_editor_update (editor);
}
}
else if (seg->prev != NULL)
{
editor->control_drag_mode = GRAD_DRAG_LEFT;
editor->control_drag_segment = seg;
}
else
{
control_select_single_segment (editor, seg);
gimp_gradient_editor_update (editor);
}
}
else /* seg == NULL */
{
/* Right handle of last segment */
seg = gimp_gradient_segment_get_last (gradient->segments);
if (bevent->state & GDK_SHIFT_MASK)
{
control_extend_selection (editor, seg, xpos);
gimp_gradient_editor_update (editor);
}
else
{
control_select_single_segment (editor, seg);
gimp_gradient_editor_update (editor);
}
}
break;
case GRAD_DRAG_MIDDLE:
if (bevent->state & GDK_SHIFT_MASK)
{
control_extend_selection (editor, seg, xpos);
gimp_gradient_editor_update (editor);
}
else
{
editor->control_drag_mode = GRAD_DRAG_MIDDLE;
editor->control_drag_segment = seg;
}
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
break;
default:
g_warning ("%s: in_handle is true, but received handle type %d.",
G_STRFUNC, in_handle);
}
}
else /* !in_handle */
{
seg = gimp_gradient_get_segment_at (gradient, xpos);
1997-11-24 22:05:25 +00:00
editor->control_drag_mode = GRAD_DRAG_ALL;
editor->control_drag_segment = seg;
editor->control_last_gx = xpos;
editor->control_orig_pos = xpos;
1997-11-24 22:05:25 +00:00
if (bevent->state & GDK_SHIFT_MASK)
editor->control_compress = TRUE;
}
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
static gboolean
control_point_in_handle (GimpGradientEditor *editor,
GimpGradient *gradient,
gint x,
gint y,
GimpGradientSegment *seg,
GradientEditorDragMode handle)
1997-11-24 22:05:25 +00:00
{
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
gint handle_pos;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
switch (handle)
{
case GRAD_DRAG_LEFT:
if (seg)
{
handle_pos = control_calc_p_pos (editor, seg->left);
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
{
seg = gimp_gradient_segment_get_last (gradient->segments);
1997-11-24 22:05:25 +00:00
handle_pos = control_calc_p_pos (editor, seg->right);
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
case GRAD_DRAG_MIDDLE:
handle_pos = control_calc_p_pos (editor, seg->middle);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
default:
g_warning ("%s: Cannot handle drag mode %d.", G_STRFUNC, handle);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
return FALSE;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
y /= 2;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if ((x >= (handle_pos - y)) && (x <= (handle_pos + y)))
return TRUE;
else
return FALSE;
}
1997-11-24 22:05:25 +00:00
/*****/
static void
control_select_single_segment (GimpGradientEditor *editor,
GimpGradientSegment *seg)
1997-11-24 22:05:25 +00:00
{
editor->control_sel_l = seg;
editor->control_sel_r = seg;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
static void
control_extend_selection (GimpGradientEditor *editor,
GimpGradientSegment *seg,
gdouble pos)
1997-11-24 22:05:25 +00:00
{
if (fabs (pos - editor->control_sel_l->left) <
fabs (pos - editor->control_sel_r->right))
editor->control_sel_l = seg;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
editor->control_sel_r = seg;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
/*****/
static void
control_motion (GimpGradientEditor *editor,
GimpGradient *gradient,
gint x)
1997-11-24 22:05:25 +00:00
{
GimpGradientSegment *seg = editor->control_drag_segment;
gdouble pos;
gdouble delta;
gchar *str = NULL;
1997-11-24 22:05:25 +00:00
switch (editor->control_drag_mode)
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
{
case GRAD_DRAG_LEFT:
pos = control_calc_g_pos (editor, x);
1997-11-24 22:05:25 +00:00
if (! editor->control_compress)
gimp_gradient_segment_set_left_pos (gradient, seg, pos);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
control_compress_left (gradient,
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
editor->control_sel_l,
editor->control_sel_r,
seg, pos);
1997-11-24 22:05:25 +00:00
str = g_strdup_printf (_("Handle position: %0.4f"), seg->left);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
case GRAD_DRAG_MIDDLE:
pos = control_calc_g_pos (editor, x);
gimp_gradient_segment_set_middle_pos (gradient, seg, pos);
1997-11-24 22:05:25 +00:00
str = g_strdup_printf (_("Handle position: %0.4f"), seg->middle);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
case GRAD_DRAG_ALL:
pos = control_calc_g_pos (editor, x);
delta = pos - editor->control_last_gx;
if ((seg->left >= editor->control_sel_l->left) &&
(seg->right <= editor->control_sel_r->right))
delta = control_move (editor,
editor->control_sel_l,
editor->control_sel_r, delta);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
delta = control_move (editor, seg, seg, delta);
1997-11-24 22:05:25 +00:00
editor->control_last_gx += delta;
1997-11-24 22:05:25 +00:00
str = g_strdup_printf (_("Distance: %0.4f"),
editor->control_last_gx -
editor->control_orig_pos);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
default:
g_warning ("%s: Attempting to move bogus handle %d.",
G_STRFUNC, editor->control_drag_mode);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
}
1997-11-24 22:05:25 +00:00
gradient_editor_set_hint (editor, str, NULL, NULL, NULL);
g_free (str);
2003-03-10 14:07:22 +00:00
gimp_gradient_editor_update (editor);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
static void
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
control_compress_left (GimpGradient *gradient,
GimpGradientSegment *range_l,
GimpGradientSegment *range_r,
GimpGradientSegment *drag_seg,
gdouble pos)
1997-11-24 22:05:25 +00:00
{
GimpGradientSegment *seg;
gdouble lbound, rbound;
gint k;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Check what we have to compress */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (!((drag_seg->left >= range_l->left) &&
((drag_seg->right <= range_r->right) || (drag_seg == range_r->next))))
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
{
/* We are compressing a segment outside the selection */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
range_l = range_r = drag_seg;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Calculate left bound for dragged hadle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (drag_seg == range_l)
lbound = range_l->prev->left + 2.0 * EPSILON;
else
{
/* Count number of segments to the left of the dragged handle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
seg = drag_seg;
k = 0;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
while (seg != range_l)
{
k++;
seg = seg->prev;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* 2*k handles have to fit */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
lbound = range_l->left + 2.0 * k * EPSILON;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Calculate right bound for dragged handle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (drag_seg == range_r->next)
rbound = range_r->next->right - 2.0 * EPSILON;
else
{
/* Count number of segments to the right of the dragged handle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
seg = drag_seg;
k = 1;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
while (seg != range_r)
{
k++;
seg = seg->next;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* 2*k handles have to fit */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
rbound = range_r->right - 2.0 * k * EPSILON;
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Calculate position */
1997-11-24 22:05:25 +00:00
pos = CLAMP (pos, lbound, rbound);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Compress segments to the left of the handle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (drag_seg == range_l)
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gimp_gradient_segment_range_compress (gradient,
range_l->prev, range_l->prev,
range_l->prev->left, pos);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gimp_gradient_segment_range_compress (gradient,
range_l, drag_seg->prev,
range_l->left, pos);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Compress segments to the right of the handle */
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (drag_seg != range_r->next)
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gimp_gradient_segment_range_compress (gradient,
drag_seg, range_r,
pos, range_r->right);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
gimp_gradient_segment_range_compress (gradient,
drag_seg, drag_seg,
pos, drag_seg->right);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
/*****/
static gdouble
control_move (GimpGradientEditor *editor,
GimpGradientSegment *range_l,
GimpGradientSegment *range_r,
gdouble delta)
1997-11-24 22:05:25 +00:00
{
GimpGradient *gradient = GIMP_GRADIENT (GIMP_DATA_EDITOR (editor)->data);
1997-11-24 22:05:25 +00:00
return gimp_gradient_segment_range_move (gradient,
range_l,
range_r,
delta,
editor->control_compress);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
/*****/
static gdouble
control_get_normalized_last_x_pos (GimpGradientEditor *editor)
{
GtkAllocation allocation;
gdouble normalized;
if (editor->control_last_x < 0)
return 0.5;
gtk_widget_get_allocation (editor->control, &allocation);
normalized = (double) editor->control_last_x / (allocation.width - 1);
if (normalized < 0)
return 0;
if (normalized > 1.0)
return 1;
return normalized;
}
/*****/
1997-11-24 22:05:25 +00:00
static void
control_update (GimpGradientEditor *editor,
GimpGradient *gradient,
gboolean reset_selection)
1997-11-24 22:05:25 +00:00
{
if (! editor->control_sel_l || ! editor->control_sel_r)
reset_selection = TRUE;
if (reset_selection)
{
if (gradient)
control_select_single_segment (editor, gradient->segments);
else
control_select_single_segment (editor, NULL);
}
gtk_widget_queue_draw (editor->control);
}
1997-11-24 22:05:25 +00:00
static void
control_draw_all (GimpGradientEditor *editor,
GimpGradient *gradient,
cairo_t *cr,
gint width,
gint height,
gdouble left,
gdouble right)
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
{
GtkStyleContext *style;
GimpGradientSegment *seg;
GradientEditorDragMode handle;
gint sel_l;
gint sel_r;
gdouble g_pos;
GtkStateFlags flags;
1997-11-24 22:05:25 +00:00
2003-03-10 14:07:22 +00:00
if (! gradient)
return;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Draw selection */
1997-11-24 22:05:25 +00:00
style = gtk_widget_get_style_context (editor->control);
app/widgets/gimpactionview.c app/widgets/gimpblobeditor.c 2008-06-28 Michael Natterer <mitch@gimp.org> * app/widgets/gimpactionview.c * app/widgets/gimpblobeditor.c * app/widgets/gimpbrushfactoryview.c * app/widgets/gimpbrushselect.c * app/widgets/gimpcellrendererdashes.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpcolorbar.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcolorframe.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcurveview.c * app/widgets/gimpdasheditor.c * app/widgets/gimpdatafactoryview.c * app/widgets/gimpdock.c * app/widgets/gimpdockable.c * app/widgets/gimpdockseparator.c * app/widgets/gimpfgbgeditor.c * app/widgets/gimpfgbgview.c * app/widgets/gimpgradienteditor.c * app/widgets/gimphandlebar.c * app/widgets/gimphistogrambox.c * app/widgets/gimphistogramview.c * app/widgets/gimpitemtreeview.c * app/widgets/gimpmenudock.c * app/widgets/gimpmessagebox.c * app/widgets/gimppaletteview.c * app/widgets/gimpscalebutton.c * app/widgets/gimpsessioninfo-book.c * app/widgets/gimpsessioninfo-dock.c * app/widgets/gimpsettingseditor.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptemplateeditor.c * app/widgets/gimptemplateview.c * app/widgets/gimpthumbbox.c * app/widgets/gimptoolbox.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimptoolview.c * app/widgets/gimpuimanager.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpwidgets-utils.c: use accessors instead of accessing members of GTK+ widgets directly. svn path=/trunk/; revision=26008
2008-06-28 15:50:27 +00:00
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
sel_l = control_calc_p_pos (editor, editor->control_sel_l->left);
sel_r = control_calc_p_pos (editor, editor->control_sel_r->right);
1997-11-24 22:05:25 +00:00
gtk_style_context_save (style);
gtk_style_context_add_class (style, GTK_STYLE_CLASS_VIEW);
gtk_render_background (style, cr, 0, 0, width, height);
gtk_style_context_set_state (style, GTK_STATE_FLAG_SELECTED);
gtk_render_background (style, cr,sel_l, 0, sel_r - sel_l + 1, height);
1997-11-24 22:05:25 +00:00
gtk_style_context_restore (style);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Draw handles */
1997-11-24 22:05:25 +00:00
flags = GTK_STATE_FLAG_NORMAL;
app/core/core-enums.h app/core/gimpgradient.[ch] app/pdb/Makefile.am 2004-05-31 Michael Natterer <mitch@gimp.org> * app/core/core-enums.h * app/core/gimpgradient.[ch] * app/pdb/Makefile.am * app/widgets/gimpgradienteditor.c * tools/pdbgen/Makefile.am * tools/pdbgen/groups.pl * tools/pdbgen/pdb/gradient_edit.pdb: applied a patch from Shlomi Fish that adds lots of gradient edit functions to gimpgradient.[ch] and makes them available through the PDB. Fixes bug #129675 and bug #129678. Did some cleanups / enhancments to the patch: * app/core/gimpgradient.[ch]: changed the naming scheme of the new functions and changed old functions to match the new scheme. Introduce a "freeze_count" and public freeze()/thaw() API which enables subsequent gradient changes without "dirty" being emitted all the time. Added GimpGradient parameters to all functions which modify the gradient. * app/widgets/gimpgradienteditor.c: use the new freeze/thaw stuff to keep the gradient from updating when not in "Instant Update" mode. * app/actions/gradient-editor-commands.c: removed all gradient editing code and call the new core functions. * libgimp/Makefile.am * tools/pdbgen/pdb/gradient_edit.pdb: changed the namespace of all added functions. Generate libgimp wrappers for them.. * app/pdb/gradient_edit_cmds.c * app/pdb/internal_procs.c * libgimp/gimp_pdb.h * libgimp/gimpenums.h * libgimp/gimpgradientedit_pdb.[ch] * plug-ins/pygimp/gimpenums.py * plug-ins/script-fu/script-fu-constants.c * tools/pdbgen/enums.pl: (re)generated.
2004-05-30 22:04:16 +00:00
for (seg = gradient->segments; seg; seg = seg->next)
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
{
if (seg == editor->control_sel_l)
flags = GTK_STATE_FLAG_SELECTED;
control_draw_handle (editor, style, cr, seg->left,
height, FALSE, flags);
control_draw_handle (editor, style, cr, seg->middle,
height, TRUE, flags);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Draw right handle only if this is the last segment */
if (seg->next == NULL)
control_draw_handle (editor, style, cr, seg->right,
height, FALSE, flags);
if (seg == editor->control_sel_r)
flags = GTK_STATE_FLAG_NORMAL;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Draw the handle which is closest to the mouse position */
1997-11-24 22:05:25 +00:00
flags = GTK_STATE_FLAG_PRELIGHT;
g_pos = control_calc_g_pos (editor, editor->control_last_x);
1997-11-24 22:05:25 +00:00
seg_get_closest_handle (gradient, CLAMP (g_pos, 0.0, 1.0), &seg, &handle);
1997-11-24 22:05:25 +00:00
if (seg && seg_in_selection (gradient, seg,
editor->control_sel_l, editor->control_sel_r))
flags |= GTK_STATE_FLAG_SELECTED;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
switch (handle)
{
case GRAD_DRAG_LEFT:
if (seg)
{
control_draw_handle (editor, style, cr, seg->left,
height, FALSE, flags);
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
{
seg = gimp_gradient_segment_get_last (gradient->segments);
if (seg == editor->control_sel_r)
flags |= GTK_STATE_FLAG_SELECTED;
control_draw_handle (editor, style, cr, seg->right,
height, FALSE, flags);
}
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
case GRAD_DRAG_MIDDLE:
control_draw_handle (editor, style, cr, seg->middle,
height, TRUE, flags);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
break;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
default:
break;
}
}
1997-11-24 22:05:25 +00:00
static void
control_draw_handle (GimpGradientEditor *editor,
GtkStyleContext *style,
cairo_t *cr,
gdouble pos,
gint height,
gboolean middle,
GtkStateFlags flags)
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
{
GdkRGBA color;
gint xpos = control_calc_p_pos (editor, pos);
gboolean selected = (flags & GTK_STATE_FLAG_SELECTED) != 0;
cairo_save (cr);
cairo_move_to (cr, xpos, 0);
cairo_line_to (cr, xpos - height / 2.0, height);
cairo_line_to (cr, xpos + height / 2.0, height);
cairo_line_to (cr, xpos, 0);
1997-11-24 22:05:25 +00:00
gtk_style_context_save (style);
gtk_style_context_add_class (style, GTK_STYLE_CLASS_VIEW);
gtk_style_context_save (style);
gtk_style_context_set_state (style, flags);
gtk_style_context_get_color (style, gtk_style_context_get_state (style),
&color);
gtk_style_context_restore (style);
if (middle)
color.alpha = 0.5;
gdk_cairo_set_source_rgba (cr, &color);
cairo_fill_preserve (cr);
1997-11-24 22:05:25 +00:00
if (selected)
gtk_style_context_set_state (style, flags &= ~GTK_STATE_FLAG_SELECTED);
else
gtk_style_context_set_state (style, flags |= GTK_STATE_FLAG_SELECTED);
gtk_style_context_get_color (style, gtk_style_context_get_state (style),
&color);
gdk_cairo_set_source_rgba (cr, &color);
cairo_set_line_width (cr, 1);
cairo_stroke (cr);
gtk_style_context_restore (style);
cairo_restore (cr);
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
/*****/
static gint
control_calc_p_pos (GimpGradientEditor *editor,
gdouble pos)
1997-11-24 22:05:25 +00:00
{
GtkAdjustment *adjustment = editor->scroll_data;
GtkAllocation allocation;
gint pwidth;
gtk_widget_get_allocation (editor->control, &allocation);
pwidth = allocation.width;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Calculate the position (in widget's coordinates) of the
* requested point from the gradient. Rounding is done to
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
* minimize mismatches between the rendered gradient view
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
* and the gradient control's handles.
*/
1997-11-24 22:05:25 +00:00
app/widgets/gimpblobeditor.c app/widgets/gimpbrushselect.c 2009-03-22 Michael Natterer <mitch@gimp.org> * app/widgets/gimpblobeditor.c * app/widgets/gimpbrushselect.c * app/widgets/gimpcolorbar.c * app/widgets/gimpcolordialog.c * app/widgets/gimpcolorframe.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontrollereditor.c * app/widgets/gimpcontrollerlist.c * app/widgets/gimpcursor.c * app/widgets/gimpcurveview.c * app/widgets/gimpdasheditor.c * app/widgets/gimpdialogfactory.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpdockable.c * app/widgets/gimperrordialog.c * app/widgets/gimpfgbgeditor.c * app/widgets/gimpfgbgview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpgradientselect.c * app/widgets/gimphandlebar.c * app/widgets/gimphistogrambox.c * app/widgets/gimphistogramview.c * app/widgets/gimpmessagedialog.c * app/widgets/gimpnavigationview.c * app/widgets/gimppaletteselect.c * app/widgets/gimppaletteview.c * app/widgets/gimppatternselect.c * app/widgets/gimpprogressbox.c * app/widgets/gimpprogressdialog.c * app/widgets/gimpscalebutton.c * app/widgets/gimpselectiondata.c * app/widgets/gimpsessioninfo.c * app/widgets/gimpsettingsbox.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptexteditor.c * app/widgets/gimptoolbox.c * app/widgets/gimpuimanager.c * app/widgets/gimpview-popup.c * app/widgets/gimpview.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpwidgets-utils.c: use accessors for various members of GTK+ structures that don't exist any longer when GSEAL_ENABLE is defined. svn path=/trunk/; revision=28193
2009-03-22 16:35:53 +00:00
return RINT ((pwidth - 1) * (pos - gtk_adjustment_get_value (adjustment)) /
gtk_adjustment_get_page_size (adjustment));
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
static gdouble
control_calc_g_pos (GimpGradientEditor *editor,
gint pos)
1997-11-24 22:05:25 +00:00
{
GtkAdjustment *adjustment = editor->scroll_data;
GtkAllocation allocation;
gint pwidth;
gtk_widget_get_allocation (editor->control, &allocation);
pwidth = allocation.width;
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
/* Calculate the gradient position that corresponds to widget's coordinates */
1997-11-24 22:05:25 +00:00
app/widgets/gimpblobeditor.c app/widgets/gimpbrushselect.c 2009-03-22 Michael Natterer <mitch@gimp.org> * app/widgets/gimpblobeditor.c * app/widgets/gimpbrushselect.c * app/widgets/gimpcolorbar.c * app/widgets/gimpcolordialog.c * app/widgets/gimpcolorframe.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainerpopup.c * app/widgets/gimpcontainertreeview.c * app/widgets/gimpcontrollereditor.c * app/widgets/gimpcontrollerlist.c * app/widgets/gimpcursor.c * app/widgets/gimpcurveview.c * app/widgets/gimpdasheditor.c * app/widgets/gimpdialogfactory.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpdockable.c * app/widgets/gimperrordialog.c * app/widgets/gimpfgbgeditor.c * app/widgets/gimpfgbgview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpgradientselect.c * app/widgets/gimphandlebar.c * app/widgets/gimphistogrambox.c * app/widgets/gimphistogramview.c * app/widgets/gimpmessagedialog.c * app/widgets/gimpnavigationview.c * app/widgets/gimppaletteselect.c * app/widgets/gimppaletteview.c * app/widgets/gimppatternselect.c * app/widgets/gimpprogressbox.c * app/widgets/gimpprogressdialog.c * app/widgets/gimpscalebutton.c * app/widgets/gimpselectiondata.c * app/widgets/gimpsessioninfo.c * app/widgets/gimpsettingsbox.c * app/widgets/gimpstrokeeditor.c * app/widgets/gimptexteditor.c * app/widgets/gimptoolbox.c * app/widgets/gimpuimanager.c * app/widgets/gimpview-popup.c * app/widgets/gimpview.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpwidgets-utils.c: use accessors for various members of GTK+ structures that don't exist any longer when GSEAL_ENABLE is defined. svn path=/trunk/; revision=28193
2009-03-22 16:35:53 +00:00
return (gtk_adjustment_get_page_size (adjustment) * pos / (pwidth - 1) +
gtk_adjustment_get_value (adjustment));
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
1997-11-24 22:05:25 +00:00
/***** Segment functions *****/
static void
seg_get_closest_handle (GimpGradient *grad,
gdouble pos,
GimpGradientSegment **seg,
GradientEditorDragMode *handle)
1997-11-24 22:05:25 +00:00
{
gdouble l_delta, m_delta, r_delta;
1997-11-24 22:05:25 +00:00
*seg = gimp_gradient_get_segment_at (grad, pos);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
m_delta = fabs (pos - (*seg)->middle);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (pos < (*seg)->middle)
{
l_delta = fabs (pos - (*seg)->left);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (l_delta < m_delta)
*handle = GRAD_DRAG_LEFT;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
*handle = GRAD_DRAG_MIDDLE;
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
else
{
r_delta = fabs (pos - (*seg)->right);
1997-11-24 22:05:25 +00:00
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
if (m_delta < r_delta)
{
*handle = GRAD_DRAG_MIDDLE;
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
else
{
*seg = (*seg)->next;
*handle = GRAD_DRAG_LEFT;
}
app/Makefile.am app/gimphelp.[ch] new files 1999-09-27 Michael Natterer <mitch@gimp.org> * app/Makefile.am * app/gimphelp.[ch] * app/gimpui.[ch]: new files * app/interface.[ch] * app/preferences_dialog.[ch] The GIMP Help System part 1: Press "F1" in any dialog to pop up the help page for this dialog. Moved the widget constructors from preferences_dialog.[ch] and the query boxes from interface.[ch] to gimpui.[ch]. The dialog constructors take a help_func and a help_data parameter and install the "F1" accelerator which emits the new "help" signal. The "help" signal callback calls help_func(help_data) which finally has to call gimp_help() which in turn invokes the help browser. Still have to find a proper way to (1) prevent "F1" being assigned to some menu item and (2) to catch "F1" while browsing the menu trees in order to pop up the help for the selected item. * app/menus.c: a <Toolbox>/File/Help... menu item. * app/commands.[ch]: a command callback for the "Help..." menu item. * app/gimprc.[ch]: new boolean gimprc variable "use_help". * app/info_dialog.[ch]: pass a help function and data to the info dialog constructor. * app/tools.[ch]: store the tools help page names in the tool info structure. Export a special tools_help_func() which shows the help page for the active tool. * app/[all files calling a dialog constructor]: pass the dialog's help page to the constructor. Most dialogs are now created by gimp_dialog_new() which also sets up the action_area and the WM delete event callback, so I removed the resp. code from these files. Fixed some minor bugs and did some other stuff but didn't change any logic except dialog creation. * plug-ins/helpbrowser/helpbrowser.c: don't try to call a running help browser and don't install any menu path (all done in app/gimphelp.[ch] now).
1999-09-27 17:58:10 +00:00
}
}
static gboolean
seg_in_selection (GimpGradient *grad,
GimpGradientSegment *seg,
GimpGradientSegment *left,
GimpGradientSegment *right)
{
GimpGradientSegment *s;
for (s = left; s; s = s->next)
{
if (s == seg)
return TRUE;
if (s == right)
break;
}
return FALSE;
}
static GtkWidget *
gradient_hint_label_add (GtkBox *box)
{
GtkWidget *label = g_object_new (GTK_TYPE_LABEL,
"xalign", 0.0,
"yalign", 0.5,
"single-line-mode", TRUE,
NULL);
gtk_box_pack_start (box, label, FALSE, FALSE, 0);
gtk_widget_show (label);
return label;
}