gimp/app/widgets/gimpfiledialog.c

802 lines
26 KiB
C
Raw Normal View History

/* GIMP - The GNU Image Manipulation Program
* Copyright (C) 1995 Spencer Kimball and Peter Mattis
*
* gimpfiledialog.c
* Copyright (C) 2004 Michael Natterer <mitch@gimp.org>
*
* This program is free software; you can redistribute it and/or modify
* it under the terms of the GNU General Public License as published by
* the Free Software Foundation; either version 2 of the License, or
* (at your option) any later version.
*
* This program is distributed in the hope that it will be useful,
* but WITHOUT ANY WARRANTY; without even the implied warranty of
* MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the
* GNU General Public License for more details.
*
* You should have received a copy of the GNU General Public License
* along with this program; if not, write to the Free Software
* Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA.
*/
#include "config.h"
#include <string.h>
#include <gtk/gtk.h>
#include "libgimpwidgets/gimpwidgets.h"
#include "widgets-types.h"
#include "core/gimp.h"
#include "core/gimpimage.h"
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
#include "core/gimpprogress.h"
#include "config/gimpguiconfig.h"
#include "file/file-utils.h"
#include "pdb/gimppdb.h"
app/plug-in/Makefile.am app/plug-in/plug-in-types.h new object which keeps 2006-04-29 Michael Natterer <mitch@gimp.org> * app/plug-in/Makefile.am * app/plug-in/plug-in-types.h * app/plug-in/gimppluginmanager.[ch]: new object which keeps all plug-in related stuff that was kept in the Gimp instance. Has "menu-branch-added" and "last-plug-in-changed" signals. * app/plug-in/plug-ins.[ch]: removed, all its functions are in GimpPlugInManager now. * app/core/gimpmarshal.list: new marshaller for the new object. * app/core/gimp.[ch]: removed all plug-in related stuff and keep a GimpPlugInManager around. * app/plug-in/plug-in-data.[ch] * app/plug-in/plug-in-file.[ch] * app/plug-in/plug-in-help-domain.[ch] * app/plug-in/plug-in-locale-domain.[ch] * app/plug-in/plug-in-menu-branch.[ch] * app/plug-in/plug-ins-query.[ch]: removed... * app/plug-in/gimppluginmanager-data.[ch] * app/plug-in/gimppluginmanager-file.[ch] * app/plug-in/gimppluginmanager-help-domain.[ch] * app/plug-in/gimppluginmanager-locale-domain.[ch] * app/plug-in/gimppluginmanager-menu-branch.[ch] * app/plug-in/gimppluginmanager-query.[ch]: ...and added as methods of GimpPlugInManager. * app/plug-in/plug-in-debug.[ch] * app/plug-in/plug-in-shm.[ch]: removed... * app/plug-in/gimpplugindebug.[ch] * app/plug-in/gimppluginshm.[ch]: ...and added as properly namespeced structs with constructors and destructors. * app/core/Makefile.am * app/core/gimpenvirontable.[ch] * app/core/gimpinterpreterdb.[ch]: removed... * app/plug-in/gimpenvirontable.[ch] * app/plug-in/gimpinterpreterdb.[ch]: ...and added here unchanged. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: remove gimp_menus_create_branch() and all related stuff. * app/actions/plug-in-actions.[ch]: connect to the plug-in-manager's "menu-path-added" signal and create menu branch actions accordingly. * app/plug-in/plug-in-context.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c * app/plug-in/plug-in-run.[ch] * app/plug-in/plug-in.[ch] * app/app_procs.c * app/actions/file-commands.c * app/actions/plug-in-commands.c * app/core/gimpimage.c * app/dialogs/file-open-location-dialog.c * app/dialogs/file-save-dialog.c * app/file/file-open.c * app/gui/gui.c * app/menus/plug-in-menus.c * app/pdb/gimppluginprocedure.c * app/pdb/gimptemporaryprocedure.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfileprocview.c * app/widgets/gimphelp.c * app/widgets/gimpthumbbox.c * app/xcf/xcf.c * tools/pdbgen/pdb/context.pdb * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/help.pdb * tools/pdbgen/pdb/message.pdb * tools/pdbgen/pdb/plug_in.pdb * tools/pdbgen/pdb/procedural_db.pdb * tools/pdbgen/pdb/progress.pdb * tools/pdbgen/pdb/undo.pdb: follow above refactoring. * app/pdb/context_cmds.c * app/pdb/drawable_cmds.c * app/pdb/fileops_cmds.c * app/pdb/help_cmds.c * app/pdb/message_cmds.c * app/pdb/plug_in_cmds.c * app/pdb/procedural_db_cmds.c * app/pdb/progress_cmds.c * app/pdb/undo_cmds.c: regenerated.
2006-04-28 22:26:51 +00:00
#include "plug-in/gimppluginmanager.h"
#include "plug-in/gimppluginprocedure.h"
#include "gimpfiledialog.h"
#include "gimpfileprocview.h"
#include "gimphelp-ids.h"
#include "gimpprogressbox.h"
#include "gimpview.h"
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
#include "gimpviewrendererimagefile.h"
#include "gimpthumbbox.h"
#include "gimpwidgets-utils.h"
#include "gimp-intl.h"
static void gimp_file_dialog_progress_iface_init (GimpProgressInterface *iface);
static gboolean gimp_file_dialog_delete_event (GtkWidget *widget,
GdkEventAny *event);
static void gimp_file_dialog_response (GtkDialog *dialog,
gint response_id);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
static GimpProgress *
gimp_file_dialog_progress_start (GimpProgress *progress,
const gchar *message,
gboolean cancelable);
static void gimp_file_dialog_progress_end (GimpProgress *progress);
static gboolean gimp_file_dialog_progress_is_active (GimpProgress *progress);
static void gimp_file_dialog_progress_set_text (GimpProgress *progress,
const gchar *message);
static void gimp_file_dialog_progress_set_value (GimpProgress *progress,
gdouble percentage);
static gdouble gimp_file_dialog_progress_get_value (GimpProgress *progress);
static void gimp_file_dialog_progress_pulse (GimpProgress *progress);
Added parent window API to the GimpProgress interface and to the libgimp 2005-09-09 Michael Natterer <mitch@gimp.org> Added parent window API to the GimpProgress interface and to the libgimp progress stuff. Might look strange, but does the right thing in almost all cases (image window, file dialog, script-fu dialog etc). Fixes bug #62988. * app/core/gimpprogress.[ch]: added GimpProgress::get_window() which should return a toplevel window ID if the progress is in a window that wants to be the transient parent of plug-in dialogs. * app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new function which returns the window handle of a GtkWindow's GdkWindow. * app/widgets/gimpfiledialog.c: implement ::get_window(). * app/display/gimpdisplay.[ch]: ditto. Removed window handle API. * app/gui/gui-vtable.c: changed accordingly. * libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand): added GIMP_PROGRESS_COMMAND_GET_WINDOW. * app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window): new function. Also renamed some functions to match the GimpProgress interface, and not the legacy PDB procedure names. * tools/pdbgen/pdb/progress.pdb * app/core/gimppdbprogress.c: implement get_window() on both sides of the wire, keeping backward compatibility (hopefully). * libgimp/gimpprogress.[ch]: deprecated gimp_progress_install() and added gimp_progress_install_vtable() which takes a vtable with padding to be extensible. Added get_window() vtable entry and dispatch it accordingly. Also added pulse() which was implemented in a hackish way before. Everything is of course backward compatible. * libgimp/gimpprogressbar.c: inmplement the get_window() stuff so a plug-in dialog containing a progress can be the transient parent of another dialog in another plug-in. * libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function which returns a foreign GdkWindow of this plug-ins progress window. Renamed gimp_window_set_transient_for_default_display() to gimp_window_set_transient() and make it use the progress' window handle instead of the display's (which is the right thing to do in almost all cases). * libgimp/gimp.def * libgimp/gimpui.def: add the new functions. * tools/pdbgen/enums.pl * app/pdb/internal_procs.c * app/pdb/progress_cmds.c * libgimp/gimpprogress_pdb.[ch]: regenerated. * libgimp/gimpexport.c * plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
static guint32 gimp_file_dialog_progress_get_window(GimpProgress *progress);
static void gimp_file_dialog_add_preview (GimpFileDialog *dialog,
Gimp *gimp);
static void gimp_file_dialog_add_filters (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs);
static void gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs,
const gchar *automatic,
const gchar *automatic_help_id);
static void gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
GimpFileDialog *dialog);
static void gimp_file_dialog_update_preview (GtkFileChooser *chooser,
GimpFileDialog *dialog);
static void gimp_file_dialog_proc_changed (GimpFileProcView *view,
GimpFileDialog *dialog);
static void gimp_file_dialog_help_func (const gchar *help_id,
gpointer help_data);
static void gimp_file_dialog_help_clicked (GtkWidget *widget,
gpointer dialog);
static gchar * gimp_file_dialog_pattern_from_extension (const gchar *extension);
G_DEFINE_TYPE_WITH_CODE (GimpFileDialog, gimp_file_dialog,
GTK_TYPE_FILE_CHOOSER_DIALOG,
G_IMPLEMENT_INTERFACE (GIMP_TYPE_PROGRESS,
gimp_file_dialog_progress_iface_init))
#define parent_class gimp_file_dialog_parent_class
static void
gimp_file_dialog_class_init (GimpFileDialogClass *klass)
{
GtkWidgetClass *widget_class = GTK_WIDGET_CLASS (klass);
GtkDialogClass *dialog_class = GTK_DIALOG_CLASS (klass);
widget_class->delete_event = gimp_file_dialog_delete_event;
dialog_class->response = gimp_file_dialog_response;
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
static void
gimp_file_dialog_init (GimpFileDialog *dialog)
{
}
static void
gimp_file_dialog_progress_iface_init (GimpProgressInterface *iface)
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
{
iface->start = gimp_file_dialog_progress_start;
iface->end = gimp_file_dialog_progress_end;
iface->is_active = gimp_file_dialog_progress_is_active;
iface->set_text = gimp_file_dialog_progress_set_text;
iface->set_value = gimp_file_dialog_progress_set_value;
iface->get_value = gimp_file_dialog_progress_get_value;
iface->pulse = gimp_file_dialog_progress_pulse;
iface->get_window = gimp_file_dialog_progress_get_window;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static gboolean
gimp_file_dialog_delete_event (GtkWidget *widget,
GdkEventAny *event)
{
return TRUE;
}
static void
gimp_file_dialog_response (GtkDialog *dialog,
gint response_id)
{
GimpFileDialog *file_dialog = GIMP_FILE_DIALOG (dialog);
if (response_id != GTK_RESPONSE_OK && file_dialog->busy)
{
file_dialog->canceled = TRUE;
if (GIMP_PROGRESS_BOX (file_dialog->progress)->active &&
GIMP_PROGRESS_BOX (file_dialog->progress)->cancelable)
{
gimp_progress_cancel (GIMP_PROGRESS (dialog));
}
}
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
static GimpProgress *
gimp_file_dialog_progress_start (GimpProgress *progress,
const gchar *message,
gboolean cancelable)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
GimpProgress *retval;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
retval = gimp_progress_start (GIMP_PROGRESS (dialog->progress),
message, cancelable);
gtk_widget_show (dialog->progress);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
return retval;
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static void
gimp_file_dialog_progress_end (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
gimp_progress_end (GIMP_PROGRESS (dialog->progress));
gtk_widget_hide (dialog->progress);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static gboolean
gimp_file_dialog_progress_is_active (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
return gimp_progress_is_active (GIMP_PROGRESS (dialog->progress));
}
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
static void
gimp_file_dialog_progress_set_text (GimpProgress *progress,
const gchar *message)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
gimp_progress_set_text (GIMP_PROGRESS (dialog->progress), message);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static void
gimp_file_dialog_progress_set_value (GimpProgress *progress,
gdouble percentage)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
gimp_progress_set_value (GIMP_PROGRESS (dialog->progress), percentage);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static gdouble
gimp_file_dialog_progress_get_value (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
return gimp_progress_get_value (GIMP_PROGRESS (dialog->progress));
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
}
static void
gimp_file_dialog_progress_pulse (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
gimp_progress_pulse (GIMP_PROGRESS (dialog->progress));
}
Added parent window API to the GimpProgress interface and to the libgimp 2005-09-09 Michael Natterer <mitch@gimp.org> Added parent window API to the GimpProgress interface and to the libgimp progress stuff. Might look strange, but does the right thing in almost all cases (image window, file dialog, script-fu dialog etc). Fixes bug #62988. * app/core/gimpprogress.[ch]: added GimpProgress::get_window() which should return a toplevel window ID if the progress is in a window that wants to be the transient parent of plug-in dialogs. * app/widgets/gimpwidgets-utils.[ch] (gimp_window_get_native): new function which returns the window handle of a GtkWindow's GdkWindow. * app/widgets/gimpfiledialog.c: implement ::get_window(). * app/display/gimpdisplay.[ch]: ditto. Removed window handle API. * app/gui/gui-vtable.c: changed accordingly. * libgimpbase/gimpbaseenums.[ch] (enum GimpProgressCommand): added GIMP_PROGRESS_COMMAND_GET_WINDOW. * app/plug-in/plug-in-progress.[ch] (plug_in_progress_get_window): new function. Also renamed some functions to match the GimpProgress interface, and not the legacy PDB procedure names. * tools/pdbgen/pdb/progress.pdb * app/core/gimppdbprogress.c: implement get_window() on both sides of the wire, keeping backward compatibility (hopefully). * libgimp/gimpprogress.[ch]: deprecated gimp_progress_install() and added gimp_progress_install_vtable() which takes a vtable with padding to be extensible. Added get_window() vtable entry and dispatch it accordingly. Also added pulse() which was implemented in a hackish way before. Everything is of course backward compatible. * libgimp/gimpprogressbar.c: inmplement the get_window() stuff so a plug-in dialog containing a progress can be the transient parent of another dialog in another plug-in. * libgimp/gimpui.[ch] (gimp_ui_get_progress_window): new function which returns a foreign GdkWindow of this plug-ins progress window. Renamed gimp_window_set_transient_for_default_display() to gimp_window_set_transient() and make it use the progress' window handle instead of the display's (which is the right thing to do in almost all cases). * libgimp/gimp.def * libgimp/gimpui.def: add the new functions. * tools/pdbgen/enums.pl * app/pdb/internal_procs.c * app/pdb/progress_cmds.c * libgimp/gimpprogress_pdb.[ch]: regenerated. * libgimp/gimpexport.c * plug-ins/*/*.c: follow API change.
2005-09-09 18:07:31 +00:00
static guint32
gimp_file_dialog_progress_get_window (GimpProgress *progress)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (progress);
return (guint32) gimp_window_get_native (GTK_WINDOW (dialog));
}
/* public functions */
GtkWidget *
gimp_file_dialog_new (Gimp *gimp,
GtkFileChooserAction action,
const gchar *title,
const gchar *role,
const gchar *stock_id,
const gchar *help_id)
{
GimpFileDialog *dialog;
GSList *file_procs;
const gchar *automatic;
const gchar *automatic_help_id;
gboolean local_only;
g_return_val_if_fail (GIMP_IS_GIMP (gimp), NULL);
g_return_val_if_fail (title != NULL, NULL);
g_return_val_if_fail (role != NULL, NULL);
g_return_val_if_fail (stock_id != NULL, NULL);
g_return_val_if_fail (help_id != NULL, NULL);
switch (action)
{
case GTK_FILE_CHOOSER_ACTION_OPEN:
app/plug-in/Makefile.am app/plug-in/plug-in-types.h new object which keeps 2006-04-29 Michael Natterer <mitch@gimp.org> * app/plug-in/Makefile.am * app/plug-in/plug-in-types.h * app/plug-in/gimppluginmanager.[ch]: new object which keeps all plug-in related stuff that was kept in the Gimp instance. Has "menu-branch-added" and "last-plug-in-changed" signals. * app/plug-in/plug-ins.[ch]: removed, all its functions are in GimpPlugInManager now. * app/core/gimpmarshal.list: new marshaller for the new object. * app/core/gimp.[ch]: removed all plug-in related stuff and keep a GimpPlugInManager around. * app/plug-in/plug-in-data.[ch] * app/plug-in/plug-in-file.[ch] * app/plug-in/plug-in-help-domain.[ch] * app/plug-in/plug-in-locale-domain.[ch] * app/plug-in/plug-in-menu-branch.[ch] * app/plug-in/plug-ins-query.[ch]: removed... * app/plug-in/gimppluginmanager-data.[ch] * app/plug-in/gimppluginmanager-file.[ch] * app/plug-in/gimppluginmanager-help-domain.[ch] * app/plug-in/gimppluginmanager-locale-domain.[ch] * app/plug-in/gimppluginmanager-menu-branch.[ch] * app/plug-in/gimppluginmanager-query.[ch]: ...and added as methods of GimpPlugInManager. * app/plug-in/plug-in-debug.[ch] * app/plug-in/plug-in-shm.[ch]: removed... * app/plug-in/gimpplugindebug.[ch] * app/plug-in/gimppluginshm.[ch]: ...and added as properly namespeced structs with constructors and destructors. * app/core/Makefile.am * app/core/gimpenvirontable.[ch] * app/core/gimpinterpreterdb.[ch]: removed... * app/plug-in/gimpenvirontable.[ch] * app/plug-in/gimpinterpreterdb.[ch]: ...and added here unchanged. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: remove gimp_menus_create_branch() and all related stuff. * app/actions/plug-in-actions.[ch]: connect to the plug-in-manager's "menu-path-added" signal and create menu branch actions accordingly. * app/plug-in/plug-in-context.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c * app/plug-in/plug-in-run.[ch] * app/plug-in/plug-in.[ch] * app/app_procs.c * app/actions/file-commands.c * app/actions/plug-in-commands.c * app/core/gimpimage.c * app/dialogs/file-open-location-dialog.c * app/dialogs/file-save-dialog.c * app/file/file-open.c * app/gui/gui.c * app/menus/plug-in-menus.c * app/pdb/gimppluginprocedure.c * app/pdb/gimptemporaryprocedure.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfileprocview.c * app/widgets/gimphelp.c * app/widgets/gimpthumbbox.c * app/xcf/xcf.c * tools/pdbgen/pdb/context.pdb * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/help.pdb * tools/pdbgen/pdb/message.pdb * tools/pdbgen/pdb/plug_in.pdb * tools/pdbgen/pdb/procedural_db.pdb * tools/pdbgen/pdb/progress.pdb * tools/pdbgen/pdb/undo.pdb: follow above refactoring. * app/pdb/context_cmds.c * app/pdb/drawable_cmds.c * app/pdb/fileops_cmds.c * app/pdb/help_cmds.c * app/pdb/message_cmds.c * app/pdb/plug_in_cmds.c * app/pdb/procedural_db_cmds.c * app/pdb/progress_cmds.c * app/pdb/undo_cmds.c: regenerated.
2006-04-28 22:26:51 +00:00
file_procs = gimp->plug_in_manager->load_procs;
automatic = _("Automatically Detected");
automatic_help_id = GIMP_HELP_FILE_OPEN_BY_EXTENSION;
/* FIXME */
app/pdb/Makefile.am app/pdb/pdb-types.h new object GimpPDB which keeps all 2006-04-26 Michael Natterer <mitch@gimp.org> * app/pdb/Makefile.am * app/pdb/pdb-types.h * app/pdb/gimppdb.[ch]: new object GimpPDB which keeps all procedures and functions to register and run them. Renamed all functions and did some cleanups. * app/pdb/gimp-pdb.[ch] * app/core/gimp.[ch]: removed the same stuff here. * app/pdb/gimp-pdb-query.[ch]: removed these files... * app/pdb/gimppdb-query.[ch]: ...added here as members of GimpPDB. * app/pdb/gimp-pdb-compat.h: fix include guard. * app/batch.c * app/actions/vectors-commands.c * app/dialogs/about-dialog.c * app/file/file-open.c * app/file/file-save.c * app/plug-in/plug-in-message.c * app/plug-in/plug-ins.c * app/widgets/gimpfiledialog.c * app/widgets/gimphelp.c * app/xcf/xcf.c * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb * tools/pdbgen/pdb/procedural_db.pdb: changed includes and function calls accordingly. * tools/pdbgen/app.pl: pass around GimpPDB instead of Gimp pointers to register the internal procedures with. Changed some newlines in the generated code. * app/pdb/*_cmds.c * app/pdb/internal_procs.[ch]: regenerated. * app/core/gimppdbprogress.[ch] * app/widgets/gimppdbdialog.[ch]: added "pdb" CONSTRUCT_ONLY properties. * app/plug-in/plug-in-progress.c * app/gui/gui-vtable.c: pass gimp->pdb when creating them. * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: use the new local pdb pointers instead of some foo->bar->gimp->pdb overkill.
2006-04-26 09:13:47 +00:00
local_only = (gimp_pdb_lookup_procedure (gimp->pdb,
"file-uri-load") == NULL);
break;
case GTK_FILE_CHOOSER_ACTION_SAVE:
app/plug-in/Makefile.am app/plug-in/plug-in-types.h new object which keeps 2006-04-29 Michael Natterer <mitch@gimp.org> * app/plug-in/Makefile.am * app/plug-in/plug-in-types.h * app/plug-in/gimppluginmanager.[ch]: new object which keeps all plug-in related stuff that was kept in the Gimp instance. Has "menu-branch-added" and "last-plug-in-changed" signals. * app/plug-in/plug-ins.[ch]: removed, all its functions are in GimpPlugInManager now. * app/core/gimpmarshal.list: new marshaller for the new object. * app/core/gimp.[ch]: removed all plug-in related stuff and keep a GimpPlugInManager around. * app/plug-in/plug-in-data.[ch] * app/plug-in/plug-in-file.[ch] * app/plug-in/plug-in-help-domain.[ch] * app/plug-in/plug-in-locale-domain.[ch] * app/plug-in/plug-in-menu-branch.[ch] * app/plug-in/plug-ins-query.[ch]: removed... * app/plug-in/gimppluginmanager-data.[ch] * app/plug-in/gimppluginmanager-file.[ch] * app/plug-in/gimppluginmanager-help-domain.[ch] * app/plug-in/gimppluginmanager-locale-domain.[ch] * app/plug-in/gimppluginmanager-menu-branch.[ch] * app/plug-in/gimppluginmanager-query.[ch]: ...and added as methods of GimpPlugInManager. * app/plug-in/plug-in-debug.[ch] * app/plug-in/plug-in-shm.[ch]: removed... * app/plug-in/gimpplugindebug.[ch] * app/plug-in/gimppluginshm.[ch]: ...and added as properly namespeced structs with constructors and destructors. * app/core/Makefile.am * app/core/gimpenvirontable.[ch] * app/core/gimpinterpreterdb.[ch]: removed... * app/plug-in/gimpenvirontable.[ch] * app/plug-in/gimpinterpreterdb.[ch]: ...and added here unchanged. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: remove gimp_menus_create_branch() and all related stuff. * app/actions/plug-in-actions.[ch]: connect to the plug-in-manager's "menu-path-added" signal and create menu branch actions accordingly. * app/plug-in/plug-in-context.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c * app/plug-in/plug-in-run.[ch] * app/plug-in/plug-in.[ch] * app/app_procs.c * app/actions/file-commands.c * app/actions/plug-in-commands.c * app/core/gimpimage.c * app/dialogs/file-open-location-dialog.c * app/dialogs/file-save-dialog.c * app/file/file-open.c * app/gui/gui.c * app/menus/plug-in-menus.c * app/pdb/gimppluginprocedure.c * app/pdb/gimptemporaryprocedure.c * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.c * app/widgets/gimpfileprocview.c * app/widgets/gimphelp.c * app/widgets/gimpthumbbox.c * app/xcf/xcf.c * tools/pdbgen/pdb/context.pdb * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/help.pdb * tools/pdbgen/pdb/message.pdb * tools/pdbgen/pdb/plug_in.pdb * tools/pdbgen/pdb/procedural_db.pdb * tools/pdbgen/pdb/progress.pdb * tools/pdbgen/pdb/undo.pdb: follow above refactoring. * app/pdb/context_cmds.c * app/pdb/drawable_cmds.c * app/pdb/fileops_cmds.c * app/pdb/help_cmds.c * app/pdb/message_cmds.c * app/pdb/plug_in_cmds.c * app/pdb/procedural_db_cmds.c * app/pdb/progress_cmds.c * app/pdb/undo_cmds.c: regenerated.
2006-04-28 22:26:51 +00:00
file_procs = gimp->plug_in_manager->save_procs;
automatic = _("By Extension");
automatic_help_id = GIMP_HELP_FILE_SAVE_BY_EXTENSION;
/* FIXME */
app/pdb/Makefile.am app/pdb/pdb-types.h new object GimpPDB which keeps all 2006-04-26 Michael Natterer <mitch@gimp.org> * app/pdb/Makefile.am * app/pdb/pdb-types.h * app/pdb/gimppdb.[ch]: new object GimpPDB which keeps all procedures and functions to register and run them. Renamed all functions and did some cleanups. * app/pdb/gimp-pdb.[ch] * app/core/gimp.[ch]: removed the same stuff here. * app/pdb/gimp-pdb-query.[ch]: removed these files... * app/pdb/gimppdb-query.[ch]: ...added here as members of GimpPDB. * app/pdb/gimp-pdb-compat.h: fix include guard. * app/batch.c * app/actions/vectors-commands.c * app/dialogs/about-dialog.c * app/file/file-open.c * app/file/file-save.c * app/plug-in/plug-in-message.c * app/plug-in/plug-ins.c * app/widgets/gimpfiledialog.c * app/widgets/gimphelp.c * app/xcf/xcf.c * tools/pdbgen/pdb/brush_select.pdb * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/font_select.pdb * tools/pdbgen/pdb/gradient_select.pdb * tools/pdbgen/pdb/palette_select.pdb * tools/pdbgen/pdb/pattern_select.pdb * tools/pdbgen/pdb/procedural_db.pdb: changed includes and function calls accordingly. * tools/pdbgen/app.pl: pass around GimpPDB instead of Gimp pointers to register the internal procedures with. Changed some newlines in the generated code. * app/pdb/*_cmds.c * app/pdb/internal_procs.[ch]: regenerated. * app/core/gimppdbprogress.[ch] * app/widgets/gimppdbdialog.[ch]: added "pdb" CONSTRUCT_ONLY properties. * app/plug-in/plug-in-progress.c * app/gui/gui-vtable.c: pass gimp->pdb when creating them. * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: use the new local pdb pointers instead of some foo->bar->gimp->pdb overkill.
2006-04-26 09:13:47 +00:00
local_only = (gimp_pdb_lookup_procedure (gimp->pdb,
"file-uri-save") == NULL);
break;
default:
g_return_val_if_reached (NULL);
return NULL;
}
dialog = g_object_new (GIMP_TYPE_FILE_DIALOG,
"title", title,
"role", role,
"action", action,
"local-only", local_only,
"do-overwrite-confirmation", TRUE,
NULL);
gtk_dialog_add_buttons (GTK_DIALOG (dialog),
GTK_STOCK_CANCEL, GTK_RESPONSE_CANCEL,
stock_id, GTK_RESPONSE_OK,
NULL);
gtk_dialog_set_default_response (GTK_DIALOG (dialog), GTK_RESPONSE_OK);
gtk_dialog_set_alternative_button_order (GTK_DIALOG (dialog),
GTK_RESPONSE_OK,
GTK_RESPONSE_CANCEL,
-1);
gimp_help_connect (GTK_WIDGET (dialog),
gimp_file_dialog_help_func, help_id, dialog);
if (GIMP_GUI_CONFIG (gimp->config)->show_help_button && help_id)
{
GtkWidget *action_area = GTK_DIALOG (dialog)->action_area;
GtkWidget *button = gtk_button_new_from_stock (GTK_STOCK_HELP);
gtk_box_pack_end (GTK_BOX (action_area), button, FALSE, TRUE, 0);
gtk_button_box_set_child_secondary (GTK_BUTTON_BOX (action_area),
button, TRUE);
gtk_widget_show (button);
g_object_set_data_full (G_OBJECT (dialog), "gimp-dialog-help-id",
g_strdup (help_id),
(GDestroyNotify) g_free);
g_signal_connect (button, "clicked",
G_CALLBACK (gimp_file_dialog_help_clicked),
dialog);
g_object_set_data (G_OBJECT (dialog), "gimp-dialog-help-button", button);
}
gimp_file_dialog_add_preview (dialog, gimp);
gimp_file_dialog_add_filters (dialog, gimp, file_procs);
gimp_file_dialog_add_proc_selection (dialog, gimp, file_procs, automatic,
automatic_help_id);
Redid the whole internal progress stuff: don't pass around 2004-08-10 Michael Natterer <mitch@gimp.org> Redid the whole internal progress stuff: don't pass around progress_callback and progress_data; instead, provide a pointer to a GimpProgressInterface which can be implemented by a variety of backends. Addresses (but not yet fixes) bugs #6010, #97266 and #135185. * app/display/Makefile.am * app/display/gimpprogress.[ch]: removed the old progress hack. * app/core/Makefile.am * app/core/core-types.h * app/core/gimpprogress.[ch]: implement GimpProgressInterface. * app/widgets/Makefile.am * app/widgets/widgets-types.h * app/widgets/gimpprogressdialog.[ch]: the standalone progress dialog as widget implementing GimpProgressInterface. * app/display/gimpdisplay.c * app/display/gimpstatusbar.[ch] * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpthumbbox.[ch]: added GimpProgressInterface implementation to these classes. * app/core/gimp-gui.[ch] * app/gui/gui-vtable.c: replaced the old progress vtable entries by two new to create and destroy a GimpProgressDialog in case no other progress is available. * app/pdb/procedural_db.[ch] * app/plug-in/plug-in-run.[ch] * tools/pdbgen/app.pl: pass a GimpProgress to all PDB wrappers and all plug-ins. * app/plug-in/plug-in.[ch] * app/plug-in/plug-ins.c * app/plug-in/plug-in-message.c * app/plug-in/plug-in-progress.c: handle the case there the plug-in was crated with a progress as well as the case where it wasn't. * app/app_procs.c * app/batch.c * app/xcf/xcf.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/widgets/gimphelp.c * app/widgets/gimpbrushselect.c * app/widgets/gimpfontselect.c * app/widgets/gimpgradientselect.c * app/widgets/gimppaletteselect.c * app/widgets/gimppatternselect.c: changed accordingly. * app/core/gimpimagefile.[ch] * app/display/gimpdisplayshell-dnd.c * app/gui/file-open-dialog.c * app/gui/file-open-location-dialog.c * app/gui/file-save-dialog.c * app/widgets/gimplayertreeview.c * app/widgets/gimptoolbox-dnd.c: pass a GimpProgress to all file related functions. Embed the progress in the file dialog where possible. * app/core/gimpdrawable-blend.[ch] * app/core/gimpdrawable-transform.[ch] * app/core/gimpimage-convert.[ch] * app/core/gimpimage-flip.[ch] * app/core/gimpimage-resize.[ch] * app/core/gimpimage-rotate.[ch] * app/core/gimpimage-scale.[ch] * app/core/gimpitem-linked.[ch] * app/core/gimpitem.[ch] * app/core/gimpchannel.c * app/core/gimpdrawable.c * app/core/gimplayer.c * app/core/gimpselection.c * app/vectors/gimpvectors.c: replaced callback/data by GimpProgress. * app/tools/gimpblendtool.c * app/tools/gimptransformtool.c * app/gui/convert-dialog.c * app/actions/documents-commands.c * app/actions/file-commands.c * app/actions/image-commands.c * app/actions/layers-commands.c * app/actions/plug-in-commands.c * app/actions/vectors-commands.c * tools/pdbgen/pdb/convert.pdb * tools/pdbgen/pdb/edit.pdb * tools/pdbgen/pdb/image.pdb * tools/pdbgen/pdb/layer.pdb: changed callers accordingly. * app/pdb/*_cmds.c: regenerated.
2004-08-10 18:47:21 +00:00
dialog->progress = gimp_progress_box_new ();
gtk_box_pack_end (GTK_BOX (GTK_DIALOG (dialog)->vbox), dialog->progress,
FALSE, FALSE, 0);
return GTK_WIDGET (dialog);
}
void
gimp_file_dialog_set_sensitive (GimpFileDialog *dialog,
gboolean sensitive)
{
GList *children;
GList *list;
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
children =
gtk_container_get_children (GTK_CONTAINER (GTK_DIALOG (dialog)->vbox));
for (list = children; list; list = g_list_next (list))
{
/* skip the last item (the action area) */
if (! g_list_next (list))
break;
gtk_widget_set_sensitive (list->data, sensitive);
}
g_list_free (children);
if (sensitive)
gtk_dialog_set_response_sensitive (GTK_DIALOG (dialog),
GTK_RESPONSE_CANCEL, sensitive);
gtk_dialog_set_response_sensitive (GTK_DIALOG (dialog),
GTK_RESPONSE_OK, sensitive);
dialog->busy = ! sensitive;
dialog->canceled = FALSE;
}
void
app/plug-in/plug-in-types.h renamed to GimpPlugInProcedure and made a 2006-04-05 Michael Natterer <mitch@gimp.org> * app/plug-in/plug-in-types.h * app/plug-in/plug-in-proc-def.[ch]: renamed to GimpPlugInProcedure and made a GObject derived from GimpProcedure (instead of having a pointer to a GimpProcedure). Added image_types and file_magic utility functions taken from plug-ins.[ch]. Still lives in the same crappy files because I am undecided where to put it... * app/pdb/gimpprocedure.c (gimp_procedure_real_execute): removed switch() statement and always call the internal marshaller because GimpProcedure::execute() is properly overridden by GimpPlugInProcedure now. * app/plug-in/plug-ins.[ch]: removed the mime_type and file_magic utilities added to GimpPlugInProcedure. * app/actions/file-commands.c * app/actions/plug-in-actions.[ch] * app/actions/plug-in-commands.[ch] * app/core/gimp-gui.[ch] * app/core/gimp.[ch] * app/core/gimpimage.[ch] * app/dialogs/file-open-dialog.c * app/dialogs/file-save-dialog.c * app/dialogs/print-size-dialog.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/file/file-utils.[ch] * app/gui/gui-vtable.c * app/menus/plug-in-menus.[ch] * app/plug-in/plug-in-def.[ch] * app/plug-in/plug-in-message.c * app/plug-in/plug-in-rc.c * app/plug-in/plug-in-run.c * app/plug-in/plug-in.c * app/plug-in/plug-ins-query.c * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpfileprocview.[ch] * app/widgets/gimppluginaction.[ch] * app/xcf/xcf.c * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/plug_in.pdb: changed addordingly. * app/pdb/fileops_cmds.c * app/pdb/plug_in_cmds.c: regenerated.
2006-04-05 08:38:33 +00:00
gimp_file_dialog_set_file_proc (GimpFileDialog *dialog,
GimpPlugInProcedure *file_proc)
{
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
if (file_proc != dialog->file_proc)
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view),
file_proc);
}
void
gimp_file_dialog_set_image (GimpFileDialog *dialog,
GimpImage *image,
gboolean save_a_copy)
{
const gchar *uri = NULL;
gchar *dirname;
gchar *basename;
g_return_if_fail (GIMP_IS_FILE_DIALOG (dialog));
g_return_if_fail (GIMP_IS_IMAGE (image));
dialog->image = image;
dialog->save_a_copy = save_a_copy;
if (save_a_copy)
uri = g_object_get_data (G_OBJECT (image), "gimp-image-save-a-copy");
if (! uri)
uri = gimp_image_get_uri (image);
gimp_file_dialog_set_file_proc (dialog, NULL);
#ifndef G_OS_WIN32
dirname = g_path_get_dirname (uri);
#else
/* g_path_get_dirname() is supposed to work on pathnames, not
* URIs.
*
* If uri points to a file on the root of a drive
* "file:///d:/foo.png", g_path_get_dirname() would return
* "file:///d:". (What we really would want is "file:///d:/".) When
* this then is passed inside gtk+ to g_filename_from_uri() we get
* "d:" which is not an absolute pathname. This currently causes an
* assertion failure in gtk+. This scenario occurs if we have opened
* an image from the root of a drive and then do Save As.
*
* Of course, gtk+ shouldn't assert even if we feed it slighly bogus
* data, and that problem should be fixed, too. But to get the
* correct default current folder in the filechooser combo box, we
* need to pass it the proper URI for an absolute path anyway. So
* don't use g_path_get_dirname() on file: URIs.
*/
if (g_str_has_prefix (uri, "file:///"))
{
char *filepath, *dirpath = NULL;
filepath = g_filename_from_uri (uri, NULL, NULL);
if (filepath != NULL)
{
dirpath = g_path_get_dirname (filepath);
g_free (filepath);
}
if (dirpath != NULL)
{
dirname = g_filename_to_uri (dirpath, NULL, NULL);
g_free (dirpath);
}
else
dirname = NULL;
}
else
dirname = g_path_get_dirname (uri);
#endif
basename = file_utils_uri_display_basename (uri);
if (dirname && strlen (dirname) && strcmp (dirname, "."))
{
gtk_file_chooser_set_current_folder_uri (GTK_FILE_CHOOSER (dialog),
dirname);
}
else if (g_object_get_data (G_OBJECT (image), "gimp-image-dirname"))
{
gtk_file_chooser_set_current_folder (GTK_FILE_CHOOSER (dialog),
g_object_get_data (G_OBJECT (image),
"gimp-image-dirname"));
}
gtk_file_chooser_set_current_name (GTK_FILE_CHOOSER (dialog), basename);
g_free (dirname);
g_free (basename);
}
/* private functions */
static void
gimp_file_dialog_add_preview (GimpFileDialog *dialog,
Gimp *gimp)
{
if (gimp->config->thumbnail_size <= 0)
return;
gtk_file_chooser_set_use_preview_label (GTK_FILE_CHOOSER (dialog), FALSE);
g_signal_connect (dialog, "selection-changed",
G_CALLBACK (gimp_file_dialog_selection_changed),
dialog);
g_signal_connect (dialog, "update-preview",
G_CALLBACK (gimp_file_dialog_update_preview),
dialog);
Changed GimpViewable preview rendering to have a context to get 2006-08-29 Michael Natterer <mitch@gimp.org> Changed GimpViewable preview rendering to have a context to get FG/BG/whatever from. Use the context to enable dynamic FG/BG colors in gradients. Fixes bug #127676 and bug #352214. Addresses bug #128367 (doesn't fix it because there's no loading/saving and no GUI yet). * app/core/core-enums.[ch]: added enum GimpGradientColor to enable specifying gradient colors in terms of foreground and background. * app/core/gimpgradient.[ch]: added color_type members to the GimpGradientSegment struct and honor them in gimp_gradient_get_color_at(). Added GimpContext parameters to all functions which finally call get_color_at(). * app/core/gimp-gradients.c: use the new method to implement the builtin gradients. * app/core/gimpviewable.[ch]: added GimpContext parameters to all get_preview() and get_pixbuf() functions. * app/core/gimpbrush.c * app/core/gimpbuffer.c * app/core/gimpdrawable-preview.[ch] * app/core/gimpgradient.c * app/core/gimpimage-preview.[ch] * app/core/gimpimagefile.c * app/core/gimppalette.c * app/core/gimppattern.c * app/core/gimpundo.[ch] * app/text/gimpfont.c * app/vectors/gimpvectors-preview.[ch]: changed ::get_preview() and ::get_pixbuf() implementations accordingly. * app/core/gimpdrawable-blend.c * app/core/gimppalette-import.[ch] * app/dialogs/dialogs-constructors.c * app/dialogs/palette-import-dialog.c * app/dialogs/resize-dialog.c * app/display/gimpdisplayshell-layer-select.c * app/display/gimpdisplayshell.c * app/display/gimpnavigationeditor.c * app/paint/gimppaintoptions.c * app/tools/gimpeditselectiontool.c * app/tools/gimptexttool.c * app/actions/gradient-editor-commands.c * app/widgets/gimpaction.c * app/widgets/gimpbrusheditor.[ch] * app/widgets/gimpbufferview.c * app/widgets/gimpcellrendererviewable.c * app/widgets/gimpchanneltreeview.c * app/widgets/gimpclipboard.c * app/widgets/gimpcoloreditor.c * app/widgets/gimpcomponenteditor.c * app/widgets/gimpcontainerbox.c * app/widgets/gimpcontainercombobox.c * app/widgets/gimpcontainereditor.c * app/widgets/gimpcontainerentry.c * app/widgets/gimpcontainergridview.c * app/widgets/gimpcontainertreeview.[ch] * app/widgets/gimpdataeditor.[ch] * app/widgets/gimpdevicestatus.c * app/widgets/gimpdnd.[ch] * app/widgets/gimpdrawabletreeview.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.[ch] * app/widgets/gimpgradientselect.c * app/widgets/gimpitemtreeview.c * app/widgets/gimplayertreeview.c * app/widgets/gimppaletteeditor.[ch] * app/widgets/gimppropwidgets.[ch] * app/widgets/gimpselectioneditor.c * app/widgets/gimpthumbbox.[ch] * app/widgets/gimptoolbox-image-area.c * app/widgets/gimptoolbox-indicator-area.c * app/widgets/gimptooloptionseditor.c * app/widgets/gimpundoeditor.c * app/widgets/gimpvectorstreeview.c * app/widgets/gimpview-popup.[ch] * app/widgets/gimpview.[ch] * app/widgets/gimpviewablebutton.c * app/widgets/gimpviewabledialog.c * app/widgets/gimpviewrenderer.[ch] * app/widgets/gimpviewrenderer-frame.c * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbuffer.c * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrendererimage.c * tools/pdbgen/pdb/drawable.pdb * tools/pdbgen/pdb/gradient.pdb * tools/pdbgen/pdb/gradients.pdb * tools/pdbgen/pdb/image.pdb: added tons of GimpContext members and parameters, implement GimpDocked::set_context() in many widgets. Pass these locally remembered contexts to GimpViewable functions. Did some minor cleanups on the way. There are still some minor FIXMEs around where the code uses a NULL context (which is allowed by the APIs) * app/pdb/drawable_cmds.c * app/pdb/gradient_cmds.c * app/pdb/gradients_cmds.c * app/pdb/image_cmds.c: regenerated.
2006-08-29 21:44:51 +00:00
dialog->thumb_box = gimp_thumb_box_new (gimp_get_user_context (gimp));
gtk_widget_set_sensitive (GTK_WIDGET (dialog->thumb_box), FALSE);
gtk_file_chooser_set_preview_widget (GTK_FILE_CHOOSER (dialog),
dialog->thumb_box);
gtk_widget_show (dialog->thumb_box);
#ifdef ENABLE_FILE_SYSTEM_ICONS
app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.c * app/widgets/gimppreviewrenderer-utils.h * app/widgets/gimppreviewrendererbrush.c * app/widgets/gimppreviewrendererbrush.h * app/widgets/gimppreviewrendererdrawable.c * app/widgets/gimppreviewrendererdrawable.h * app/widgets/gimppreviewrenderergradient.c * app/widgets/gimppreviewrenderergradient.h * app/widgets/gimppreviewrendererimage.c * app/widgets/gimppreviewrendererimage.h * app/widgets/gimppreviewrendererimagefile.c * app/widgets/gimppreviewrendererimagefile.h * app/widgets/gimppreviewrendererlayer.c * app/widgets/gimppreviewrendererlayer.h * app/widgets/gimppreviewrenderervectors.c * app/widgets/gimppreviewrenderervectors.h: Renamed all these files... * app/widgets/gimpviewrenderer-utils.c * app/widgets/gimpviewrenderer-utils.h * app/widgets/gimpviewrendererbrush.c * app/widgets/gimpviewrendererbrush.h * app/widgets/gimpviewrendererdrawable.c * app/widgets/gimpviewrendererdrawable.h * app/widgets/gimpviewrenderergradient.c * app/widgets/gimpviewrenderergradient.h * app/widgets/gimpviewrendererimage.c * app/widgets/gimpviewrendererimage.h * app/widgets/gimpviewrendererimagefile.c * app/widgets/gimpviewrendererimagefile.h * app/widgets/gimpviewrendererlayer.c * app/widgets/gimpviewrendererlayer.h * app/widgets/gimpviewrenderervectors.c * app/widgets/gimpviewrenderervectors.h: ... to these names. And also changed all the GimpPreviewRenderer* types to GimpViewRenderer* ones. * app/tools/gimppaintoptions-gui.c * app/widgets/Makefile.am * app/widgets/gimpcomponenteditor.c * app/widgets/gimpfiledialog.c * app/widgets/gimpgradienteditor.c * app/widgets/gimpview.c * app/widgets/widgets-types.h * app/widgets/gimpviewrenderer.c * app/widgets/gimpviewrenderer.h: modified accordingly.
2004-08-26 14:20:30 +00:00
GIMP_VIEW_RENDERER_IMAGEFILE (GIMP_VIEW (GIMP_THUMB_BOX (dialog->thumb_box)->preview)->renderer)->file_system = _gtk_file_chooser_get_file_system (GTK_FILE_CHOOSER (dialog));
#endif
}
static void
gimp_file_dialog_add_filters (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs)
{
GtkFileFilter *all;
GSList *list;
all = gtk_file_filter_new ();
gtk_file_filter_set_name (all, _("All files"));
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), all);
gtk_file_filter_add_pattern (all, "*");
all = gtk_file_filter_new ();
gtk_file_filter_set_name (all, _("All images"));
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), all);
for (list = file_procs; list; list = g_slist_next (list))
{
app/plug-in/plug-in-types.h renamed to GimpPlugInProcedure and made a 2006-04-05 Michael Natterer <mitch@gimp.org> * app/plug-in/plug-in-types.h * app/plug-in/plug-in-proc-def.[ch]: renamed to GimpPlugInProcedure and made a GObject derived from GimpProcedure (instead of having a pointer to a GimpProcedure). Added image_types and file_magic utility functions taken from plug-ins.[ch]. Still lives in the same crappy files because I am undecided where to put it... * app/pdb/gimpprocedure.c (gimp_procedure_real_execute): removed switch() statement and always call the internal marshaller because GimpProcedure::execute() is properly overridden by GimpPlugInProcedure now. * app/plug-in/plug-ins.[ch]: removed the mime_type and file_magic utilities added to GimpPlugInProcedure. * app/actions/file-commands.c * app/actions/plug-in-actions.[ch] * app/actions/plug-in-commands.[ch] * app/core/gimp-gui.[ch] * app/core/gimp.[ch] * app/core/gimpimage.[ch] * app/dialogs/file-open-dialog.c * app/dialogs/file-save-dialog.c * app/dialogs/print-size-dialog.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/file/file-utils.[ch] * app/gui/gui-vtable.c * app/menus/plug-in-menus.[ch] * app/plug-in/plug-in-def.[ch] * app/plug-in/plug-in-message.c * app/plug-in/plug-in-rc.c * app/plug-in/plug-in-run.c * app/plug-in/plug-in.c * app/plug-in/plug-ins-query.c * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpfileprocview.[ch] * app/widgets/gimppluginaction.[ch] * app/xcf/xcf.c * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/plug_in.pdb: changed addordingly. * app/pdb/fileops_cmds.c * app/pdb/plug_in_cmds.c: regenerated.
2006-04-05 08:38:33 +00:00
GimpPlugInProcedure *file_proc = list->data;
if (file_proc->extensions_list)
{
GtkFileFilter *filter = gtk_file_filter_new ();
gchar *label;
GString *str;
GSList *ext;
gint i;
label = gimp_plug_in_manager_get_label (gimp->plug_in_manager,
file_proc);
str = g_string_new (label);
g_free (label);
/* an arbitrary limit to keep the file dialog from becoming too wide */
#define MAX_EXTENSIONS 4
for (ext = file_proc->extensions_list, i = 0;
ext;
ext = g_slist_next (ext), i++)
{
const gchar *extension = ext->data;
gchar *pattern;
pattern = gimp_file_dialog_pattern_from_extension (extension);
gtk_file_filter_add_pattern (filter, pattern);
gtk_file_filter_add_pattern (all, pattern);
g_free (pattern);
if (i == 0)
{
g_string_append (str, " (");
}
else if (i <= MAX_EXTENSIONS)
{
g_string_append (str, ", ");
}
if (i < MAX_EXTENSIONS)
{
g_string_append (str, "*.");
g_string_append (str, extension);
}
else if (i == MAX_EXTENSIONS)
{
g_string_append (str, "...");
}
if (! ext->next)
{
g_string_append (str, ")");
}
}
gtk_file_filter_set_name (filter, str->str);
g_string_free (str, TRUE);
gtk_file_chooser_add_filter (GTK_FILE_CHOOSER (dialog), filter);
}
}
gtk_file_chooser_set_filter (GTK_FILE_CHOOSER (dialog), all);
}
static void
gimp_file_dialog_add_proc_selection (GimpFileDialog *dialog,
Gimp *gimp,
GSList *file_procs,
const gchar *automatic,
const gchar *automatic_help_id)
{
GtkWidget *scrolled_window;
dialog->proc_expander = gtk_expander_new_with_mnemonic (NULL);
gtk_file_chooser_set_extra_widget (GTK_FILE_CHOOSER (dialog),
dialog->proc_expander);
gtk_widget_show (dialog->proc_expander);
scrolled_window = gtk_scrolled_window_new (NULL, NULL);
gtk_scrolled_window_set_policy (GTK_SCROLLED_WINDOW (scrolled_window),
GTK_POLICY_AUTOMATIC, GTK_POLICY_AUTOMATIC);
gtk_scrolled_window_set_shadow_type (GTK_SCROLLED_WINDOW (scrolled_window),
GTK_SHADOW_IN);
gtk_container_add (GTK_CONTAINER (dialog->proc_expander), scrolled_window);
gtk_widget_show (scrolled_window);
gtk_widget_set_size_request (scrolled_window, -1, 200);
dialog->proc_view = gimp_file_proc_view_new (gimp, file_procs, automatic,
automatic_help_id);
gtk_container_add (GTK_CONTAINER (scrolled_window), dialog->proc_view);
gtk_widget_show (dialog->proc_view);
g_signal_connect (dialog->proc_view, "changed",
G_CALLBACK (gimp_file_dialog_proc_changed),
dialog);
gimp_file_proc_view_set_proc (GIMP_FILE_PROC_VIEW (dialog->proc_view), NULL);
}
static void
gimp_file_dialog_selection_changed (GtkFileChooser *chooser,
GimpFileDialog *dialog)
{
gimp_thumb_box_take_uris (GIMP_THUMB_BOX (dialog->thumb_box),
gtk_file_chooser_get_uris (chooser));
}
static void
gimp_file_dialog_update_preview (GtkFileChooser *chooser,
GimpFileDialog *dialog)
{
gchar *uri = gtk_file_chooser_get_preview_uri (chooser);
gimp_thumb_box_set_uri (GIMP_THUMB_BOX (dialog->thumb_box), uri);
g_free (uri);
}
static void
gimp_file_dialog_proc_changed (GimpFileProcView *view,
GimpFileDialog *dialog)
{
GtkFileChooser *chooser = GTK_FILE_CHOOSER (dialog);
gchar *name;
dialog->file_proc = gimp_file_proc_view_get_proc (view, &name);
if (name)
{
gchar *label = g_strdup_printf (_("Select File _Type (%s)"), name);
gtk_expander_set_label (GTK_EXPANDER (dialog->proc_expander), label);
g_free (label);
g_free (name);
}
if (gtk_file_chooser_get_action (chooser) == GTK_FILE_CHOOSER_ACTION_SAVE)
{
app/plug-in/plug-in-types.h renamed to GimpPlugInProcedure and made a 2006-04-05 Michael Natterer <mitch@gimp.org> * app/plug-in/plug-in-types.h * app/plug-in/plug-in-proc-def.[ch]: renamed to GimpPlugInProcedure and made a GObject derived from GimpProcedure (instead of having a pointer to a GimpProcedure). Added image_types and file_magic utility functions taken from plug-ins.[ch]. Still lives in the same crappy files because I am undecided where to put it... * app/pdb/gimpprocedure.c (gimp_procedure_real_execute): removed switch() statement and always call the internal marshaller because GimpProcedure::execute() is properly overridden by GimpPlugInProcedure now. * app/plug-in/plug-ins.[ch]: removed the mime_type and file_magic utilities added to GimpPlugInProcedure. * app/actions/file-commands.c * app/actions/plug-in-actions.[ch] * app/actions/plug-in-commands.[ch] * app/core/gimp-gui.[ch] * app/core/gimp.[ch] * app/core/gimpimage.[ch] * app/dialogs/file-open-dialog.c * app/dialogs/file-save-dialog.c * app/dialogs/print-size-dialog.c * app/file/file-open.[ch] * app/file/file-save.[ch] * app/file/file-utils.[ch] * app/gui/gui-vtable.c * app/menus/plug-in-menus.[ch] * app/plug-in/plug-in-def.[ch] * app/plug-in/plug-in-message.c * app/plug-in/plug-in-rc.c * app/plug-in/plug-in-run.c * app/plug-in/plug-in.c * app/plug-in/plug-ins-query.c * app/widgets/gimpactiongroup.[ch] * app/widgets/gimpdnd-xds.c * app/widgets/gimpfiledialog.[ch] * app/widgets/gimpfileprocview.[ch] * app/widgets/gimppluginaction.[ch] * app/xcf/xcf.c * tools/pdbgen/pdb/fileops.pdb * tools/pdbgen/pdb/plug_in.pdb: changed addordingly. * app/pdb/fileops_cmds.c * app/pdb/plug_in_cmds.c: regenerated.
2006-04-05 08:38:33 +00:00
GimpPlugInProcedure *proc = dialog->file_proc;
if (proc && proc->extensions_list)
{
gchar *uri = gtk_file_chooser_get_uri (chooser);
if (uri && strlen (uri))
{
const gchar *last_dot = strrchr (uri, '.');
/* if the dot is before the last slash, ignore it */
if (last_dot && strrchr (uri, '/') > last_dot)
last_dot = NULL;
/* check if the uri has a "meta extension" (e.g. foo.bar.gz)
* and try to truncate both extensions away.
*/
if (last_dot && last_dot != uri)
{
GList *list;
for (list = view->meta_extensions;
list;
list = g_list_next (list))
{
const gchar *ext = list->data;
if (! strcmp (ext, last_dot + 1))
{
const gchar *p = last_dot - 1;
while (p > uri && *p != '.')
p--;
if (p != uri && *p == '.')
{
last_dot = p;
break;
}
}
}
}
if (last_dot != uri)
{
GString *s = g_string_new (uri);
gchar *basename;
if (last_dot)
g_string_truncate (s, last_dot - uri);
g_string_append (s, ".");
g_string_append (s, (gchar *) proc->extensions_list->data);
gtk_file_chooser_set_uri (chooser, s->str);
basename = file_utils_uri_display_basename (s->str);
gtk_file_chooser_set_current_name (chooser, basename);
g_free (basename);
g_string_free (s, TRUE);
}
}
g_free (uri);
}
}
}
static void
gimp_file_dialog_help_func (const gchar *help_id,
gpointer help_data)
{
GimpFileDialog *dialog = GIMP_FILE_DIALOG (help_data);
GtkWidget *focus;
focus = gtk_window_get_focus (GTK_WINDOW (dialog));
if (focus == dialog->proc_view)
{
gchar *proc_help_id;
proc_help_id =
gimp_file_proc_view_get_help_id (GIMP_FILE_PROC_VIEW (dialog->proc_view));
gimp_standard_help_func (proc_help_id, NULL);
g_free (proc_help_id);
}
else
{
gimp_standard_help_func (help_id, NULL);
}
}
static void
gimp_file_dialog_help_clicked (GtkWidget *widget,
gpointer dialog)
{
gimp_standard_help_func (g_object_get_data (dialog, "gimp-dialog-help-id"),
NULL);
}
static gchar *
gimp_file_dialog_pattern_from_extension (const gchar *extension)
{
gchar *pattern;
gchar *p;
gint len, i;
g_return_val_if_fail (extension != NULL, NULL);
/* This function assumes that file extensions are 7bit ASCII. It
* could certainly be rewritten to handle UTF-8 if this assumption
* turns out to be incorrect.
*/
len = strlen (extension);
pattern = g_new (gchar, 4 + 4 * len);
strcpy (pattern, "*.");
for (i = 0, p = pattern + 2; i < len; i++, p+= 4)
{
p[0] = '[';
p[1] = g_ascii_tolower (extension[i]);
p[2] = g_ascii_toupper (extension[i]);
p[3] = ']';
}
*p = '\0';
return pattern;
}